Recombinant Human MOSPD3 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : MOSPD3-425H
Product Overview : MOSPD3 MS Standard C13 and N15-labeled recombinant protein (NP_076438) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq, Jul 2008]
Molecular Mass : 25.5 kDa
AA Sequence : MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MOSPD3 motile sperm domain containing 3 [ Homo sapiens (human) ]
Official Symbol MOSPD3
Synonyms MOSPD3; motile sperm domain containing 3; motile sperm domain-containing protein 3; CDS3; NET30;
Gene ID 64598
mRNA Refseq NM_023948
Protein Refseq NP_076438
MIM 609125
UniProt ID O75425

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOSPD3 Products

Required fields are marked with *

My Review for All MOSPD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon