Recombinant Full Length Human MOSPD3 Protein, GST-tagged

Cat.No. : MOSPD3-6317HF
Product Overview : Human MOSPD3 full-length ORF ( NP_076438.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 235 amino acids
Description : This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq
Molecular Mass : 51.9 kDa
AA Sequence : MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MOSPD3 motile sperm domain containing 3 [ Homo sapiens ]
Official Symbol MOSPD3
Synonyms MOSPD3; motile sperm domain containing 3; motile sperm domain-containing protein 3; CDS3; NET30;
Gene ID 64598
mRNA Refseq NM_001040097
Protein Refseq NP_001035186
MIM 609125
UniProt ID O75425

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MOSPD3 Products

Required fields are marked with *

My Review for All MOSPD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon