Recombinant Full Length Human MOSPD3 Protein, GST-tagged
Cat.No. : | MOSPD3-6317HF |
Product Overview : | Human MOSPD3 full-length ORF ( NP_076438.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 235 amino acids |
Description : | This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. Alternate transcriptional splice variants, encoding different isoforms, have been described. [provided by RefSeq |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MOSPD3 motile sperm domain containing 3 [ Homo sapiens ] |
Official Symbol | MOSPD3 |
Synonyms | MOSPD3; motile sperm domain containing 3; motile sperm domain-containing protein 3; CDS3; NET30; |
Gene ID | 64598 |
mRNA Refseq | NM_001040097 |
Protein Refseq | NP_001035186 |
MIM | 609125 |
UniProt ID | O75425 |
◆ Cell & Tissue Lysates | ||
MOSPD3-4243HCL | Recombinant Human MOSPD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MOSPD3 Products
Required fields are marked with *
My Review for All MOSPD3 Products
Required fields are marked with *