Recombinant Human MPO protein, His-tagged
| Cat.No. : | MPO-493H |
| Product Overview : | Recombinant Human MPO(165-278aa) fused with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 165-278aa |
| Description : | Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils. |
| Molecular Mass : | 17.4kD |
| AA Sequence : | VTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPT DQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTG |
| Gene Name | MPO myeloperoxidase [ Homo sapiens ] |
| Official Symbol | MPO |
| Synonyms | MPO; myeloperoxidase; |
| Gene ID | 4353 |
| mRNA Refseq | NM_000250 |
| Protein Refseq | NP_000241 |
| MIM | 606989 |
| UniProt ID | P05164 |
| Chromosome Location | 17q21.3-q23 |
| Pathway | C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; |
| Function | chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity; |
| ◆ Recombinant Proteins | ||
| MPO-0030H | Recombinant Human MPO Protein | +Inquiry |
| MPO-5651M | Recombinant Mouse MPO Protein, His (Fc)-Avi-tagged | +Inquiry |
| MPO-54H | Recombinant Human Myeloperoxidase | +Inquiry |
| MPO-4004H | Recombinant Human MPO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Mpo-1790R | Recombinant Rat Mpo Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MPO-01H | Active Native Human MPO Protein | +Inquiry |
| MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
| MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *



