Recombinant Human MPO protein, His-tagged
Cat.No. : | MPO-493H |
Product Overview : | Recombinant Human MPO(165-278aa) fused with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 165-278aa |
Description : | Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils. |
Molecular Mass : | 17.4kD |
AA Sequence : | VTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPT DQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTG |
Gene Name | MPO myeloperoxidase [ Homo sapiens ] |
Official Symbol | MPO |
Synonyms | MPO; myeloperoxidase; |
Gene ID | 4353 |
mRNA Refseq | NM_000250 |
Protein Refseq | NP_000241 |
MIM | 606989 |
UniProt ID | P05164 |
Chromosome Location | 17q21.3-q23 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; |
Function | chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity; |
◆ Recombinant Proteins | ||
MPO-0279H | Recombinant Human MPO protein, His-tagged | +Inquiry |
MPO-63H | Recombinant Human Myeloperoxidase | +Inquiry |
Mpo-4123M | Recombinant Mouse Mpo Protein, Myc/DDK-tagged | +Inquiry |
MPO-9990M | Recombinant Mouse MPO Protein | +Inquiry |
MPO-2943H | Recombinant Human MPO Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MPO-01H | Active Native Human MPO Protein | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *
0
Inquiry Basket