Recombinant Human MPZL3 Protein, GST-tagged
Cat.No. : | MPZL3-5528H |
Product Overview : | Human MPZL3 full-length ORF ( NP_938016.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MPZL3 (Myelin Protein Zero Like 3) is a Protein Coding gene. An important paralog of this gene is MPZ. |
Molecular Mass : | 52.4 kDa |
AA Sequence : | MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MPZL3 myelin protein zero-like 3 [ Homo sapiens ] |
Official Symbol | MPZL3 |
Synonyms | MPZL3; myelin protein zero-like 3; myelin protein zero-like protein 3; |
Gene ID | 196264 |
mRNA Refseq | NM_198275 |
Protein Refseq | NP_938016 |
MIM | 611707 |
UniProt ID | Q6UWV2 |
◆ Recombinant Proteins | ||
MPZL3-12385Z | Recombinant Zebrafish MPZL3 | +Inquiry |
RFL34765BF | Recombinant Full Length Bovine Myelin Protein Zero-Like Protein 3(Mpzl3) Protein, His-Tagged | +Inquiry |
RFL3286XF | Recombinant Full Length Xenopus Laevis Myelin Protein Zero-Like Protein 3(Mpzl3) Protein, His-Tagged | +Inquiry |
MPZL3-4567C | Recombinant Chicken MPZL3 | +Inquiry |
MPZL3-481H | Recombinant Human MPZL3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZL3-4216HCL | Recombinant Human MPZL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZL3 Products
Required fields are marked with *
My Review for All MPZL3 Products
Required fields are marked with *