Recombinant Human MPZL3 Protein, GST-tagged

Cat.No. : MPZL3-5528H
Product Overview : Human MPZL3 full-length ORF ( NP_938016.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MPZL3 (Myelin Protein Zero Like 3) is a Protein Coding gene. An important paralog of this gene is MPZ.
Molecular Mass : 52.4 kDa
AA Sequence : MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MPZL3 myelin protein zero-like 3 [ Homo sapiens ]
Official Symbol MPZL3
Synonyms MPZL3; myelin protein zero-like 3; myelin protein zero-like protein 3;
Gene ID 196264
mRNA Refseq NM_198275
Protein Refseq NP_938016
MIM 611707
UniProt ID Q6UWV2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPZL3 Products

Required fields are marked with *

My Review for All MPZL3 Products

Required fields are marked with *

0
cart-icon