Recombinant Human MRE11A protein, His-tagged

Cat.No. : MRE11A-2895H
Product Overview : Recombinant Human MRE11A protein(170-400 aa), fused to His tag, was expressed in E. coli.
Availability September 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 170-400 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MRE11A MRE11 meiotic recombination 11 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol MRE11A
Synonyms MRE11A; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); meiotic recombination (S. cerevisiae) 11 homolog A , MRE11; double-strand break repair protein MRE11A; AT like disease; ATLD; AT-like disease; MRE11 homolog 1; MRE11 homolog A; endo/exonuclease Mre11; meiotic recombination 11 homolog 1; meiotic recombination 11 homolog A; DNA recombination and repair protein; HNGS1; MRE11; MRE11B;
Gene ID 4361
mRNA Refseq NM_005590
Protein Refseq NP_005581
MIM 600814
UniProt ID P49959

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRE11A Products

Required fields are marked with *

My Review for All MRE11A Products

Required fields are marked with *

0
cart-icon