Recombinant Human MRE11A protein, His-tagged
Cat.No. : | MRE11A-2895H |
Product Overview : | Recombinant Human MRE11A protein(170-400 aa), fused to His tag, was expressed in E. coli. |
Availability | June 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 170-400 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QKGSTKIALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MRE11A MRE11 meiotic recombination 11 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | MRE11A |
Synonyms | MRE11A; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); meiotic recombination (S. cerevisiae) 11 homolog A , MRE11; double-strand break repair protein MRE11A; AT like disease; ATLD; AT-like disease; MRE11 homolog 1; MRE11 homolog A; endo/exonuclease Mre11; meiotic recombination 11 homolog 1; meiotic recombination 11 homolog A; DNA recombination and repair protein; HNGS1; MRE11; MRE11B; |
Gene ID | 4361 |
mRNA Refseq | NM_005590 |
Protein Refseq | NP_005581 |
MIM | 600814 |
UniProt ID | P49959 |
◆ Recombinant Proteins | ||
MRE11A-28636TH | Recombinant Human MRE11A | +Inquiry |
MRE11A-6342C | Recombinant Chicken MRE11A | +Inquiry |
MRE11A-3407R | Recombinant Rat MRE11A Protein, His (Fc)-Avi-tagged | +Inquiry |
MRE11A-6354HF | Recombinant Full Length Human MRE11A Protein, GST-tagged | +Inquiry |
MRE11A-3748R | Recombinant Rat MRE11A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRE11A-4211HCL | Recombinant Human MRE11A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRE11A Products
Required fields are marked with *
My Review for All MRE11A Products
Required fields are marked with *
0
Inquiry Basket