Recombinant Human MRPL13 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPL13-4697H |
Product Overview : | MRPL13 MS Standard C13 and N15-labeled recombinant protein (NP_054797) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. |
Molecular Mass : | 20.7 kDa |
AA Sequence : | MSSFSRAPQQWATFARIWYLLDGKMQPPGKLAAMASIRLQGLHKPVYHALSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPEDYRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPL13 mitochondrial ribosomal protein L13 [ Homo sapiens (human) ] |
Official Symbol | MRPL13 |
Synonyms | MRPL13; mitochondrial ribosomal protein L13; 39S ribosomal protein L13, mitochondrial; L13; L13A; L13mt; RPL13; RPML13; MRP-L13; |
Gene ID | 28998 |
mRNA Refseq | NM_014078 |
Protein Refseq | NP_054797 |
MIM | 610200 |
UniProt ID | Q9BYD1 |
◆ Recombinant Proteins | ||
MRPL13-2654R | Recombinant Rhesus Macaque MRPL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL13-10045M | Recombinant Mouse MRPL13 Protein | +Inquiry |
MRPL13-2834R | Recombinant Rhesus monkey MRPL13 Protein, His-tagged | +Inquiry |
MRPL13-2727Z | Recombinant Zebrafish MRPL13 | +Inquiry |
MRPL13-4697H | Recombinant Human MRPL13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL13-4196HCL | Recombinant Human MRPL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL13 Products
Required fields are marked with *
My Review for All MRPL13 Products
Required fields are marked with *