Recombinant Human MRPL22, His-tagged
| Cat.No. : | MRPL22-145H |
| Product Overview : | Recombinant Human 39S Ribosomal Protein L22 Mitochondrial/MRPL22 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile41-Leu206) of Human MRPL22 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 41-206 a.a. |
| AA Sequence : | ISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDK KGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFV KLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTLVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | MRPL22 mitochondrial ribosomal protein L22 [ Homo sapiens ] |
| Official Symbol | MRPL22 |
| Synonyms | MRPL22; mitochondrial ribosomal protein L22; 39S ribosomal protein L22, mitochondrial; HSPC158; MRP L25; RPML25; L25mt; 39S ribosomal protein L25, mitochondrial; L22mt; MRP-L22; MRP-L25; DKFZp781F1071; |
| Gene ID | 29093 |
| mRNA Refseq | NM_001014990 |
| Protein Refseq | NP_001014990 |
| MIM | 611835 |
| UniProt ID | Q9NWU5 |
| Chromosome Location | 5q33.2 |
| Function | structural constituent of ribosome; |
| ◆ Recombinant Proteins | ||
| MRPL22-3767R | Recombinant Rat MRPL22 Protein | +Inquiry |
| MRPL22-6571Z | Recombinant Zebrafish MRPL22 | +Inquiry |
| MRPL22-145H | Recombinant Human MRPL22, His-tagged | +Inquiry |
| MRPL22-2839R | Recombinant Rhesus monkey MRPL22 Protein, His-tagged | +Inquiry |
| MRPL22-3426R | Recombinant Rat MRPL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRPL22-4187HCL | Recombinant Human MRPL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL22 Products
Required fields are marked with *
My Review for All MRPL22 Products
Required fields are marked with *
