Recombinant Human MRPL22, His-tagged

Cat.No. : MRPL22-145H
Product Overview : Recombinant Human 39S Ribosomal Protein L22 Mitochondrial/MRPL22 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ile41-Leu206) of Human MRPL22 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 41-206 a.a.
AA Sequence : ISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDK KGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFV KLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name MRPL22 mitochondrial ribosomal protein L22 [ Homo sapiens ]
Official Symbol MRPL22
Synonyms MRPL22; mitochondrial ribosomal protein L22; 39S ribosomal protein L22, mitochondrial; HSPC158; MRP L25; RPML25; L25mt; 39S ribosomal protein L25, mitochondrial; L22mt; MRP-L22; MRP-L25; DKFZp781F1071;
Gene ID 29093
mRNA Refseq NM_001014990
Protein Refseq NP_001014990
MIM 611835
UniProt ID Q9NWU5
Chromosome Location 5q33.2
Function structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL22 Products

Required fields are marked with *

My Review for All MRPL22 Products

Required fields are marked with *

0
cart-icon