Recombinant Human MRPL28 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MRPL28-5258H
• Product Overview: MRPL28 MS Standard C13 and N15-labeled recombinant protein (NP_006419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion.
• Molecular Mass: 30.2 kDa
• AA Sequence: MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MRPL28 mitochondrial ribosomal protein L28 [ Homo sapiens (human) ]
• Official Symbol: MRPL28
• Synonyms: MRPL28; mitochondrial ribosomal protein L28; MAAT1, melanoma associated antigen recognised by cytotoxic T lymphocytes; 39S ribosomal protein L28, mitochondrial; p15; L28mt; MRP-L28; melanoma antigen p15; melanoma-associated antigen recognized by T lymphocytes; melanoma-associated antigen recognized by T-lymphocytes; melanoma-associated antigen recognised by cytotoxic T lymphocytes; MAAT1; MGC8499
• Gene ID: 10573
• mRNA Refseq: NM_006428
• Protein Refseq: NP_006419
• MIM: 604853
• UniProt ID: Q13084