Recombinant Human MRPL28 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MRPL28-5258H |
Product Overview : | MRPL28 MS Standard C13 and N15-labeled recombinant protein (NP_006419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion. |
Molecular Mass : | 30.2 kDa |
AA Sequence : | MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MRPL28 mitochondrial ribosomal protein L28 [ Homo sapiens (human) ] |
Official Symbol | MRPL28 |
Synonyms | MRPL28; mitochondrial ribosomal protein L28; MAAT1, melanoma associated antigen recognised by cytotoxic T lymphocytes; 39S ribosomal protein L28, mitochondrial; p15; L28mt; MRP-L28; melanoma antigen p15; melanoma-associated antigen recognized by T lymphocytes; melanoma-associated antigen recognized by T-lymphocytes; melanoma-associated antigen recognised by cytotoxic T lymphocytes; MAAT1; MGC8499; |
Gene ID | 10573 |
mRNA Refseq | NM_006428 |
Protein Refseq | NP_006419 |
MIM | 604853 |
UniProt ID | Q13084 |
◆ Recombinant Proteins | ||
MRPL28-3004Z | Recombinant Zebrafish MRPL28 | +Inquiry |
MRPL28-10057M | Recombinant Mouse MRPL28 Protein | +Inquiry |
MRPL28-3012C | Recombinant Chicken MRPL28 | +Inquiry |
MRPL28-4415H | Recombinant Human MRPL28 protein, GST-tagged | +Inquiry |
MRPL28-363H | Recombinant Human mitochondrial ribosomal protein L28, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL28-4182HCL | Recombinant Human MRPL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL28 Products
Required fields are marked with *
My Review for All MRPL28 Products
Required fields are marked with *