Recombinant Human MRPL28 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MRPL28-5258H
Product Overview : MRPL28 MS Standard C13 and N15-labeled recombinant protein (NP_006419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion.
Molecular Mass : 30.2 kDa
AA Sequence : MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MRPL28 mitochondrial ribosomal protein L28 [ Homo sapiens (human) ]
Official Symbol MRPL28
Synonyms MRPL28; mitochondrial ribosomal protein L28; MAAT1, melanoma associated antigen recognised by cytotoxic T lymphocytes; 39S ribosomal protein L28, mitochondrial; p15; L28mt; MRP-L28; melanoma antigen p15; melanoma-associated antigen recognized by T lymphocytes; melanoma-associated antigen recognized by T-lymphocytes; melanoma-associated antigen recognised by cytotoxic T lymphocytes; MAAT1; MGC8499;
Gene ID 10573
mRNA Refseq NM_006428
Protein Refseq NP_006419
MIM 604853
UniProt ID Q13084

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL28 Products

Required fields are marked with *

My Review for All MRPL28 Products

Required fields are marked with *

0
cart-icon