Recombinant Human MRPL30 Protein, GST-tagged
Cat.No. : | MRPL30-5574H |
Product Overview : | Human MRPL30 full-length ORF ( NP_660213.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Sequence analysis identified at least two transcript variants encoding the same protein. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. [provided by RefSeq |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPL30 mitochondrial ribosomal protein L30 [ Homo sapiens (human) ] |
Official Symbol | MRPL30 |
Synonyms | MRPL30; mitochondrial ribosomal protein L30; L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M; 39S ribosomal protein L30, mitochondrial; 39S ribosomal protein L28, mitochondrial; mitochondrial large ribosomal subunit protein uL30m |
Gene ID | 51263 |
mRNA Refseq | NM_145212 |
Protein Refseq | NP_660213 |
MIM | 611838 |
UniProt ID | Q8TCC3 |
◆ Recombinant Proteins | ||
Mrpl30-343M | Recombinant Mouse Mrpl30 Protein, MYC/DDK-tagged | +Inquiry |
MRPL30-5574H | Recombinant Human MRPL30 Protein, GST-tagged | +Inquiry |
MRPL30-3512H | Recombinant Human MRPL30 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL30-10059M | Recombinant Mouse MRPL30 Protein | +Inquiry |
MRPL30-5695M | Recombinant Mouse MRPL30 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL30-4180HCL | Recombinant Human MRPL30 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL30 Products
Required fields are marked with *
My Review for All MRPL30 Products
Required fields are marked with *
0
Inquiry Basket