Recombinant Human MRPL40, His-tagged
Cat.No. : | MRPL40-146H |
Product Overview : | Recombinant Human 39S Ribosomal Protein L40 Mitochondrial/MRPL40 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser47-Arg206) of Human MRPL40 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 47-206 a.a. |
AA Sequence : | SEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEET ERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGP HYTPPIPNYQPPEGRYNDITKVYTQVEFKRVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | MRPL40 mitochondrial ribosomal protein L40 [ Homo sapiens ] |
Official Symbol | MRPL40 |
Synonyms | MRPL40; mitochondrial ribosomal protein L40; NLVCF, nuclear localization signal deleted in velocardiofacial syndrome; 39S ribosomal protein L40, mitochondrial; MRP L22; L40mt; MRP-L40; up-regulated in metastasis; nuclear localization signal deleted in velocardiofacial syndrome; nuclear localization signal containing protein deleted in velocardiofacial syndrome; nuclear localization signal-containing protein deleted in velocardiofacial syndrome; URIM; NLVCF; MRP-L22; MGC9400; FLJ41774; |
Gene ID | 64976 |
mRNA Refseq | NM_003776 |
Protein Refseq | NP_003767 |
MIM | 605089 |
UniProt ID | Q9NQ50 |
Chromosome Location | 22q11.2 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
MRPL40-4633H | Recombinant Human MRPL40 protein, His-tagged | +Inquiry |
MRPL40-3432R | Recombinant Rat MRPL40 Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPL40-1331Z | Recombinant Zebrafish MRPL40 | +Inquiry |
MRPL40-1003H | Recombinant Human MRPL40, GST-tagged | +Inquiry |
MRPL40-146H | Recombinant Human MRPL40, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL40-4169HCL | Recombinant Human MRPL40 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPL40 Products
Required fields are marked with *
My Review for All MRPL40 Products
Required fields are marked with *