Recombinant Human MRPL40, His-tagged

Cat.No. : MRPL40-146H
Product Overview : Recombinant Human 39S Ribosomal Protein L40 Mitochondrial/MRPL40 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser47-Arg206) of Human MRPL40 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 47-206 a.a.
AA Sequence : SEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEET ERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGP HYTPPIPNYQPPEGRYNDITKVYTQVEFKRVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name MRPL40 mitochondrial ribosomal protein L40 [ Homo sapiens ]
Official Symbol MRPL40
Synonyms MRPL40; mitochondrial ribosomal protein L40; NLVCF, nuclear localization signal deleted in velocardiofacial syndrome; 39S ribosomal protein L40, mitochondrial; MRP L22; L40mt; MRP-L40; up-regulated in metastasis; nuclear localization signal deleted in velocardiofacial syndrome; nuclear localization signal containing protein deleted in velocardiofacial syndrome; nuclear localization signal-containing protein deleted in velocardiofacial syndrome; URIM; NLVCF; MRP-L22; MGC9400; FLJ41774;
Gene ID 64976
mRNA Refseq NM_003776
Protein Refseq NP_003767
MIM 605089
UniProt ID Q9NQ50
Chromosome Location 22q11.2
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL40 Products

Required fields are marked with *

My Review for All MRPL40 Products

Required fields are marked with *

0
cart-icon