Recombinant Human MRPL50 Protein, GST-tagged

Cat.No. : MRPL50-5594H
Product Overview : Human MRPL50 full-length ORF ( NP_061924.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q. [provided by RefSeq
Molecular Mass : 44.7 kDa
AA Sequence : MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPL50 mitochondrial ribosomal protein L50 [ Homo sapiens ]
Official Symbol MRPL50
Synonyms MRPL50; mitochondrial ribosomal protein L50; 39S ribosomal protein L50, mitochondrial; FLJ20493; mitochondrial 39S ribosomal protein L50; MRP L50; L50mt; MRP-L50; FLJ21990;
Gene ID 54534
mRNA Refseq NM_019051
Protein Refseq NP_061924
MIM 611854
UniProt ID Q8N5N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL50 Products

Required fields are marked with *

My Review for All MRPL50 Products

Required fields are marked with *

0
cart-icon
0
compare icon