Recombinant Human MRPS27 Protein, GST-tagged

• Cat.No.: MRPS27-5616H
• Product Overview: Human MRPS27 full-length ORF ( AAH30521, 51 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq
• Molecular Mass: 38.72 kDa
• AA Sequence: SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MRPS27 mitochondrial ribosomal protein S27 [ Homo sapiens ]
• Official Symbol: MRPS27
• Synonyms: MRPS27; mitochondrial ribosomal protein S27; 28S ribosomal protein S27, mitochondrial; KIAA0264; mitochondrial 28S ribosomal protein S27; S27mt; MRP-S27; FLJ21764; FLJ23348; FLJ38645
• Gene ID: 23107
• mRNA Refseq: NM_015084
• Protein Refseq: NP_055899
• MIM: 611989
• UniProt ID: Q92552