Recombinant Human MRPS27 Protein, GST-tagged

Cat.No. : MRPS27-5616H
Product Overview : Human MRPS27 full-length ORF ( AAH30521, 51 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq
Molecular Mass : 38.72 kDa
AA Sequence : SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS27 mitochondrial ribosomal protein S27 [ Homo sapiens ]
Official Symbol MRPS27
Synonyms MRPS27; mitochondrial ribosomal protein S27; 28S ribosomal protein S27, mitochondrial; KIAA0264; mitochondrial 28S ribosomal protein S27; S27mt; MRP-S27; FLJ21764; FLJ23348; FLJ38645;
Gene ID 23107
mRNA Refseq NM_015084
Protein Refseq NP_055899
MIM 611989
UniProt ID Q92552

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS27 Products

Required fields are marked with *

My Review for All MRPS27 Products

Required fields are marked with *

0
cart-icon
0
compare icon