Recombinant Human MRPS27 Protein, GST-tagged
Cat.No. : | MRPS27-5616H |
Product Overview : | Human MRPS27 full-length ORF ( AAH30521, 51 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that may be a functional partner of the death associated protein 3 (DAP3). [provided by RefSeq |
Molecular Mass : | 38.72 kDa |
AA Sequence : | SEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS27 mitochondrial ribosomal protein S27 [ Homo sapiens ] |
Official Symbol | MRPS27 |
Synonyms | MRPS27; mitochondrial ribosomal protein S27; 28S ribosomal protein S27, mitochondrial; KIAA0264; mitochondrial 28S ribosomal protein S27; S27mt; MRP-S27; FLJ21764; FLJ23348; FLJ38645; |
Gene ID | 23107 |
mRNA Refseq | NM_015084 |
Protein Refseq | NP_055899 |
MIM | 611989 |
UniProt ID | Q92552 |
◆ Recombinant Proteins | ||
MRPS27-516H | Recombinant Human MRPS27 protein, GST-tagged | +Inquiry |
MRPS27-5616H | Recombinant Human MRPS27 Protein, GST-tagged | +Inquiry |
MRPS27-6495HF | Recombinant Full Length Human MRPS27 Protein, GST-tagged | +Inquiry |
MRPS27-1111Z | Recombinant Zebrafish MRPS27 | +Inquiry |
MRPS27-5722M | Recombinant Mouse MRPS27 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS27-4139HCL | Recombinant Human MRPS27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRPS27 Products
Required fields are marked with *
My Review for All MRPS27 Products
Required fields are marked with *
0
Inquiry Basket