Recombinant Human MS4A1
| Cat.No. : | MS4A1-11H |
| Product Overview : | Recombinant Human MS4A1 encoding human MS4A1 full-length ORFproduced in in vitro wheat germ expression system with proprietary liposome technology. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. |
| Sequence : | MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRES KTLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAA TEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRA HTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAGI VENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDI EIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
| MolecularWeight : | 33.1kDa |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ] |
| Official Symbol | MS4A1 |
| Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16; B-lymphocyte antigen CD20; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; MGC3969; OTTHUMP00000236377; OTTHUMP00000236378 |
| Gene ID | 931 |
| mRNA Refseq | NM_021950 |
| Protein Refseq | NP_068769 |
| MIM | 118910 |
| UniProt ID | P11836 |
| Chromosome Location | 11q12 |
| Pathway | Hematopoietic cell lineage |
| Function | epidermal growth factor receptor binding |
| ◆ Recombinant Proteins | ||
| MS4A1-5732M | Recombinant Mouse MS4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MS4A1-7308HAF488 | Recombinant Human MS4A1 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| MS4A1-20H | Recombinant Human MS4A1 protein(204-291 aa), GST-tagged | +Inquiry |
| MS4A1-17H | Active Recombinant Human MS4A1 protein, Fc-tagged | +Inquiry |
| MS4A1-1649H | Recombinant Human MS4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
| MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
| MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *
