Recombinant Human MS4A1

Cat.No. : MS4A1-11H
Product Overview : Recombinant Human MS4A1 encoding human MS4A1 full-length ORFproduced in in vitro wheat germ expression system with proprietary liposome technology.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Sequence : MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRES KTLGAVQIMNGLFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAA TEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRA HTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAGI VENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDI EIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
MolecularWeight : 33.1kDa
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ]
Official Symbol MS4A1
Synonyms MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B1; S7; Bp35; CD20; CVID5; MS4A2; LEU-16; B-lymphocyte antigen CD20; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; MGC3969; OTTHUMP00000236377; OTTHUMP00000236378
Gene ID 931
mRNA Refseq NM_021950
Protein Refseq NP_068769
MIM 118910
UniProt ID P11836
Chromosome Location 11q12
Pathway Hematopoietic cell lineage
Function epidermal growth factor receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A1 Products

Required fields are marked with *

My Review for All MS4A1 Products

Required fields are marked with *

0
cart-icon