Recombinant Human MS4A8B Protein, GST-tagged

Cat.No. : MS4A8B-5644H
Product Overview : Human MS4A8B full-length ORF ( AAH22895, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq
Molecular Mass : 53.24 kDa
AA Sequence : MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MS4A8B membrane-spanning 4-domains, subfamily A, member 8B [ Homo sapiens ]
Official Symbol MS4A8B
Synonyms MS4A8B; membrane-spanning 4-domains, subfamily A, member 8B; membrane-spanning 4-domains subfamily A member 8B; MS4A4; four-span transmembrane protein 4; 4SPAN4;
Gene ID 83661
mRNA Refseq NM_031457
Protein Refseq NP_113645
MIM 606549
UniProt ID Q9BY19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A8B Products

Required fields are marked with *

My Review for All MS4A8B Products

Required fields are marked with *

0
cart-icon