Recombinant Human MSH4 Protein, GST-tagged

• Cat.No.: MSH4-5651H
• Product Overview: Human MSH4 partial ORF ( NP_002431, 831 a.a. - 936 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the DNA mismatch repair mutS family. This member is a meiosis-specific protein that is not involved in DNA mismatch correction, but is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis I. This protein and MSH5 form a heterodimer which binds uniquely to a Holliday Junction and its developmental progenitor, thus provoking ADP-ATP exchange, and stabilizing the interaction between parental chromosomes during meiosis double-stranded break repair. [provided by RefSeq, Aug 2011]
• Molecular Mass: 37.4 kDa
• AA Sequence: YKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSH4 mutS homolog 4 (E. coli) [ Homo sapiens ]
• Official Symbol: MSH4
• Synonyms: MSH4; mutS homolog 4 (E. coli); mutS (E. coli) homolog 4; mutS protein homolog 4; hMSH4
• Gene ID: 4438
• mRNA Refseq: NM_002440
• Protein Refseq: NP_002431
• MIM: 602105
• UniProt ID: O15457