Recombinant Human MSH4 Protein, GST-tagged

Cat.No. : MSH4-5651H
Product Overview : Human MSH4 partial ORF ( NP_002431, 831 a.a. - 936 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the DNA mismatch repair mutS family. This member is a meiosis-specific protein that is not involved in DNA mismatch correction, but is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis I. This protein and MSH5 form a heterodimer which binds uniquely to a Holliday Junction and its developmental progenitor, thus provoking ADP-ATP exchange, and stabilizing the interaction between parental chromosomes during meiosis double-stranded break repair. [provided by RefSeq, Aug 2011]
Molecular Mass : 37.4 kDa
AA Sequence : YKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSH4 mutS homolog 4 (E. coli) [ Homo sapiens ]
Official Symbol MSH4
Synonyms MSH4; mutS homolog 4 (E. coli); mutS (E. coli) homolog 4; mutS protein homolog 4; hMSH4;
Gene ID 4438
mRNA Refseq NM_002440
Protein Refseq NP_002431
MIM 602105
UniProt ID O15457

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSH4 Products

Required fields are marked with *

My Review for All MSH4 Products

Required fields are marked with *

0
cart-icon