Recombinant Human MSH4 Protein, GST-tagged
| Cat.No. : | MSH4-5651H |
| Product Overview : | Human MSH4 partial ORF ( NP_002431, 831 a.a. - 936 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the DNA mismatch repair mutS family. This member is a meiosis-specific protein that is not involved in DNA mismatch correction, but is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis I. This protein and MSH5 form a heterodimer which binds uniquely to a Holliday Junction and its developmental progenitor, thus provoking ADP-ATP exchange, and stabilizing the interaction between parental chromosomes during meiosis double-stranded break repair. [provided by RefSeq, Aug 2011] |
| Molecular Mass : | 37.4 kDa |
| AA Sequence : | YKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MSH4 mutS homolog 4 (E. coli) [ Homo sapiens ] |
| Official Symbol | MSH4 |
| Synonyms | MSH4; mutS homolog 4 (E. coli); mutS (E. coli) homolog 4; mutS protein homolog 4; hMSH4; |
| Gene ID | 4438 |
| mRNA Refseq | NM_002440 |
| Protein Refseq | NP_002431 |
| MIM | 602105 |
| UniProt ID | O15457 |
| ◆ Recombinant Proteins | ||
| MSH4-5651H | Recombinant Human MSH4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSH4-4119HCL | Recombinant Human MSH4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH4 Products
Required fields are marked with *
My Review for All MSH4 Products
Required fields are marked with *
