Recombinant Human MSH5 protein, His-tagged
Cat.No. : | MSH5-3844H |
Product Overview : | Recombinant Human MSH5 protein(635-835 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 635-835 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IHSCESISLGLSTFMIDLNQQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MSH5 mutS homolog 5 (E. coli) [ Homo sapiens ] |
Official Symbol | MSH5 |
Synonyms | MSH5; mutS homolog 5 (E. coli); mutS (E. coli) homolog 5; mutS protein homolog 5; G7; NG23; MUTSH5; MGC2939; DKFZp434C1615; |
Gene ID | 4439 |
mRNA Refseq | NM_002441 |
Protein Refseq | NP_002432 |
MIM | 603382 |
UniProt ID | O43196 |
◆ Recombinant Proteins | ||
MSH5-3447R | Recombinant Rat MSH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSH5-2013H | Recombinant Human MSH5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSH5-1240H | Recombinant Human MSH5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MSH5-5652H | Recombinant Human MSH5 Protein, GST-tagged | +Inquiry |
Msh5-4187M | Recombinant Mouse Msh5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSH5-4118HCL | Recombinant Human MSH5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSH5 Products
Required fields are marked with *
My Review for All MSH5 Products
Required fields are marked with *
0
Inquiry Basket