Recombinant Human MSH5 protein, His-tagged
| Cat.No. : | MSH5-3844H |
| Product Overview : | Recombinant Human MSH5 protein(635-835 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 635-835 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | IHSCESISLGLSTFMIDLNQQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MSH5 mutS homolog 5 (E. coli) [ Homo sapiens ] |
| Official Symbol | MSH5 |
| Synonyms | MSH5; mutS homolog 5 (E. coli); mutS (E. coli) homolog 5; mutS protein homolog 5; G7; NG23; MUTSH5; MGC2939; DKFZp434C1615; |
| Gene ID | 4439 |
| mRNA Refseq | NM_002441 |
| Protein Refseq | NP_002432 |
| MIM | 603382 |
| UniProt ID | O43196 |
| ◆ Recombinant Proteins | ||
| Msh5-4187M | Recombinant Mouse Msh5 Protein, Myc/DDK-tagged | +Inquiry |
| MSH5-3447R | Recombinant Rat MSH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSH5-5652H | Recombinant Human MSH5 Protein, GST-tagged | +Inquiry |
| MSH5-2013H | Recombinant Human MSH5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MSH5-3844H | Recombinant Human MSH5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSH5-4118HCL | Recombinant Human MSH5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH5 Products
Required fields are marked with *
My Review for All MSH5 Products
Required fields are marked with *
