Recombinant Human MSH5 Protein, GST-tagged
| Cat.No. : | MSH5-5652H |
| Product Overview : | Human MSH5 partial ORF ( AAH02498, 736 a.a. - 835 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. Alternative splicing results in four transcript variants encoding three different isoforms. [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | GNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MSH5 mutS homolog 5 (E. coli) [ Homo sapiens ] |
| Official Symbol | MSH5 |
| Synonyms | MSH5; mutS homolog 5 (E. coli); mutS (E. coli) homolog 5; mutS protein homolog 5; G7; NG23; MUTSH5; MGC2939; DKFZp434C1615; |
| Gene ID | 4439 |
| mRNA Refseq | NM_002441 |
| Protein Refseq | NP_002432 |
| MIM | 603382 |
| UniProt ID | O43196 |
| ◆ Recombinant Proteins | ||
| MSH5-3447R | Recombinant Rat MSH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MSH5-3788R | Recombinant Rat MSH5 Protein | +Inquiry |
| MSH5-3844H | Recombinant Human MSH5 protein, His-tagged | +Inquiry |
| Msh5-4187M | Recombinant Mouse Msh5 Protein, Myc/DDK-tagged | +Inquiry |
| MSH5-5652H | Recombinant Human MSH5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MSH5-4118HCL | Recombinant Human MSH5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH5 Products
Required fields are marked with *
My Review for All MSH5 Products
Required fields are marked with *
