Recombinant Human MSH6 protein, His-SUMO-tagged
Cat.No. : | MSH6-3246H |
Product Overview : | Recombinant Human MSH6 protein(P52701)(1-400aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-400aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60.1 kDa |
AA Sequence : | MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MSH6 mutS homolog 6 (E. coli) [ Homo sapiens ] |
Official Symbol | MSH6 |
Synonyms | MSH6; mutS homolog 6 (E. coli); GTBP, mutS (E. coli) homolog 6; DNA mismatch repair protein Msh6; p160; GTMBP; hMSH6; sperm-associated protein; mutS-alpha 160 kDa subunit; G/T mismatch-binding protein; GTBP; HSAP; HNPCC5; |
Gene ID | 2956 |
mRNA Refseq | NM_000179 |
Protein Refseq | NP_000170 |
MIM | 600678 |
UniProt ID | P52701 |
◆ Recombinant Proteins | ||
MSH6-2414H | Recombinant Human MSH6, GST-tagged | +Inquiry |
MSH6-2693R | Recombinant Rhesus Macaque MSH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSH6-2412H | Recombinant Human MSH6, GST-tagged | +Inquiry |
MSH6-2413H | Recombinant Human MSH6, His-tagged | +Inquiry |
MSH6-2873R | Recombinant Rhesus monkey MSH6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSH6-4117HCL | Recombinant Human MSH6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSH6 Products
Required fields are marked with *
My Review for All MSH6 Products
Required fields are marked with *