Recombinant Human MSI1
Cat.No. : | MSI1-30259TH |
Product Overview : | Recombinant full length Human Musashi 1 / Msi1 with a proprietary tag; Predicted MWt 65.89 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 362 amino acids |
Description : | This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. |
Molecular Weight : | 65.890kDa inclusive of tags |
Tissue specificity : | Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH |
Sequence Similarities : | Belongs to the Musashi family.Contains 2 RRM (RNA recognition motif) domains. |
Gene Name | MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | MSI1 |
Synonyms | MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1; |
Gene ID | 4440 |
mRNA Refseq | NM_002442 |
Protein Refseq | NP_002433 |
MIM | 603328 |
Uniprot ID | O43347 |
Chromosome Location | 12q24 |
Pathway | mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem; |
Function | RNA binding; nucleotide binding; poly(U) RNA binding; single-stranded RNA binding; |
◆ Recombinant Proteins | ||
MSI1-2184Z | Recombinant Zebrafish MSI1 | +Inquiry |
MSI1-3448R | Recombinant Rat MSI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSI1-5653H | Recombinant Human MSI1 Protein, GST-tagged | +Inquiry |
MSI1-5741M | Recombinant Mouse MSI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Msi1-4188M | Recombinant Mouse Msi1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSI1-4116HCL | Recombinant Human MSI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSI1 Products
Required fields are marked with *
My Review for All MSI1 Products
Required fields are marked with *
0
Inquiry Basket