Recombinant Full Length Human MSI1 Protein
Cat.No. : | MSI1-317HF |
Product Overview : | Recombinant full length Human Musashi 1 / Msi1 with a proprietary tag; Predicted MWt 65.89 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 362 amino acids |
Description : | This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. |
Form : | Liquid |
Molecular Mass : | 65.890kDa inclusive of tags |
AA Sequence : | METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | MSI1 |
Synonyms | MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1 |
Gene ID | 4440 |
mRNA Refseq | NM_002442 |
Protein Refseq | NP_002433 |
MIM | 603328 |
UniProt ID | O43347 |
◆ Recombinant Proteins | ||
Msi1-4188M | Recombinant Mouse Msi1 Protein, Myc/DDK-tagged | +Inquiry |
MSI1-10135M | Recombinant Mouse MSI1 Protein | +Inquiry |
MSI1-1440H | Recombinant Human MSI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSI1-3448R | Recombinant Rat MSI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSI1-5653H | Recombinant Human MSI1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSI1-4116HCL | Recombinant Human MSI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSI1 Products
Required fields are marked with *
My Review for All MSI1 Products
Required fields are marked with *