Recombinant Full Length Human MSI1 Protein

Cat.No. : MSI1-317HF
Product Overview : Recombinant full length Human Musashi 1 / Msi1 with a proprietary tag; Predicted MWt 65.89 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 362 amino acids
Description : This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Form : Liquid
Molecular Mass : 65.890kDa inclusive of tags
AA Sequence : METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol MSI1
Synonyms MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1
Gene ID 4440
mRNA Refseq NM_002442
Protein Refseq NP_002433
MIM 603328
UniProt ID O43347

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSI1 Products

Required fields are marked with *

My Review for All MSI1 Products

Required fields are marked with *

0
cart-icon