Recombinant Human MSRB3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MSRB3-971H
Product Overview : MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.
Molecular Mass : 20 kDa
AA Sequence : MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MSRB3 methionine sulfoxide reductase B3 [ Homo sapiens (human) ]
Official Symbol MSRB3
Synonyms MSRB3; methionine sulfoxide reductase B3; deafness, autosomal recessive 74, DFNB74; methionine-R-sulfoxide reductase B3; DKFZp686C1178; FLJ36866; methionine-R-sulfoxide reductase B3, mitochondrial; DFNB74;
Gene ID 253827
mRNA Refseq NM_001031679
Protein Refseq NP_001026849
MIM 613719
UniProt ID Q8IXL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSRB3 Products

Required fields are marked with *

My Review for All MSRB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon