Recombinant Human MSRB3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MSRB3-971H
• Product Overview: MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.
• Molecular Mass: 20 kDa
• AA Sequence: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MSRB3 methionine sulfoxide reductase B3 [ Homo sapiens (human) ]
• Official Symbol: MSRB3
• Synonyms: MSRB3; methionine sulfoxide reductase B3; deafness, autosomal recessive 74, DFNB74; methionine-R-sulfoxide reductase B3; DKFZp686C1178; FLJ36866; methionine-R-sulfoxide reductase B3, mitochondrial; DFNB74
• Gene ID: 253827
• mRNA Refseq: NM_001031679
• Protein Refseq: NP_001026849
• MIM: 613719
• UniProt ID: Q8IXL7