Recombinant Human MSRB3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MSRB3-971H |
Product Overview : | MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. |
Molecular Mass : | 20 kDa |
AA Sequence : | MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MSRB3 methionine sulfoxide reductase B3 [ Homo sapiens (human) ] |
Official Symbol | MSRB3 |
Synonyms | MSRB3; methionine sulfoxide reductase B3; deafness, autosomal recessive 74, DFNB74; methionine-R-sulfoxide reductase B3; DKFZp686C1178; FLJ36866; methionine-R-sulfoxide reductase B3, mitochondrial; DFNB74; |
Gene ID | 253827 |
mRNA Refseq | NM_001031679 |
Protein Refseq | NP_001026849 |
MIM | 613719 |
UniProt ID | Q8IXL7 |
◆ Recombinant Proteins | ||
MSRB3-326Z | Recombinant Zebrafish MSRB3 | +Inquiry |
MSRB3-301275H | Recombinant Human MSRB3 protein, GST-tagged | +Inquiry |
MSRB3-966H | Recombinant Human MSRB3, His-tagged | +Inquiry |
MSRB3-332H | Active Recombinant Human Methionine Sulfoxide Reductase B3, His-tagged | +Inquiry |
MSRB3-5668H | Recombinant Human MSRB3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSRB3-4106HCL | Recombinant Human MSRB3 293 Cell Lysate | +Inquiry |
MSRB3-4107HCL | Recombinant Human MSRB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MSRB3 Products
Required fields are marked with *
My Review for All MSRB3 Products
Required fields are marked with *