Recombinant Human MST1 protein(371-470 aa), C-His-tagged
| Cat.No. : | MST1-2704H |
| Product Overview : | Recombinant Human MST1 protein(P26927)(371-470 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 371-470 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 13.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | YHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGK |
| Gene Name | MST1 macrophage stimulating 1 (hepatocyte growth factor-like) [ Homo sapiens ] |
| Official Symbol | MST1 |
| Synonyms | MST1; macrophage stimulating 1 (hepatocyte growth factor-like); D3F15S2, DNF15S2, HGFL; hepatocyte growth factor-like protein; hepatocyte growth factor like protein homolog; MSP; NF15S2; macrophage-stimulating protein; hepatocyte growth factor-like protein homolog; HGFL; D3F15S2; DNF15S2; |
| Gene ID | 4485 |
| mRNA Refseq | NM_020998 |
| Protein Refseq | NP_066278 |
| MIM | 142408 |
| UniProt ID | P26927 |
| ◆ Recombinant Proteins | ||
| MST1-111HFL | Active Recombinant Full Length Human MST1 Protein, N-His-tagged | +Inquiry |
| MST1-2088H | Recombinant Human MST1 Protein, MYC/DDK-tagged | +Inquiry |
| MST1-6766C | Recombinant Chicken MST1 | +Inquiry |
| MST1-9446Z | Recombinant Zebrafish MST1 | +Inquiry |
| MST1-0126H | Recombinant Human MST1 Protein (G2-G711), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MST1-1139HCL | Recombinant Human MST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MST1 Products
Required fields are marked with *
My Review for All MST1 Products
Required fields are marked with *
