Recombinant Human MST1 protein(371-470 aa), C-His-tagged

Cat.No. : MST1-2704H
Product Overview : Recombinant Human MST1 protein(P26927)(371-470 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 371-470 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 13.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : YHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGK
Gene Name MST1 macrophage stimulating 1 (hepatocyte growth factor-like) [ Homo sapiens ]
Official Symbol MST1
Synonyms MST1; macrophage stimulating 1 (hepatocyte growth factor-like); D3F15S2, DNF15S2, HGFL; hepatocyte growth factor-like protein; hepatocyte growth factor like protein homolog; MSP; NF15S2; macrophage-stimulating protein; hepatocyte growth factor-like protein homolog; HGFL; D3F15S2; DNF15S2;
Gene ID 4485
mRNA Refseq NM_020998
Protein Refseq NP_066278
MIM 142408
UniProt ID P26927

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MST1 Products

Required fields are marked with *

My Review for All MST1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon