Recombinant Human MTARC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MTARC1-3406H
• Product Overview: MOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_073583) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles. As a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. May be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. Postulated to cleave the N-OH bond of N-hydroxylated substrates in concert with electron transfer from NADH to cytochrome b5 reductase then to cytochrome b5, the ultimate electron donor that primes the active site for substrate reduction.
• Molecular Mass: 37.5 kDa
• AA Sequence: MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MTARC1 mitochondrial amidoxime reducing component 1 [ Homo sapiens (human) ]
• Official Symbol: MTARC1
• Synonyms: MARC1; mitochondrial amidoxime reducing component 1; MARC1; MOSC1; mitochondrial amidoxime-reducing component 1; MOCO sulphurase C-terminal domain containing 1; MOSC domain-containing protein 1, mitochondrial; moco sulfurase C-terminal domain-containing protein 1; molybdenum cofactor sulfurase C-terminal domain-containing protein 1
• Gene ID: 64757
• mRNA Refseq: NM_022746
• Protein Refseq: NP_073583
• MIM: 614126
• UniProt ID: Q5VT66