Recombinant Human MTARC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MTARC1-3406H
Product Overview : MOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_073583) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles. As a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. May be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. Postulated to cleave the N-OH bond of N-hydroxylated substrates in concert with electron transfer from NADH to cytochrome b5 reductase then to cytochrome b5, the ultimate electron donor that primes the active site for substrate reduction.
Molecular Mass : 37.5 kDa
AA Sequence : MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MTARC1 mitochondrial amidoxime reducing component 1 [ Homo sapiens (human) ]
Official Symbol MTARC1
Synonyms MARC1; mitochondrial amidoxime reducing component 1; MARC1; MOSC1; mitochondrial amidoxime-reducing component 1; MOCO sulphurase C-terminal domain containing 1; MOSC domain-containing protein 1, mitochondrial; moco sulfurase C-terminal domain-containing protein 1; molybdenum cofactor sulfurase C-terminal domain-containing protein 1
Gene ID 64757
mRNA Refseq NM_022746
Protein Refseq NP_073583
MIM 614126
UniProt ID Q5VT66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTARC1 Products

Required fields are marked with *

My Review for All MTARC1 Products

Required fields are marked with *

0
cart-icon