Recombinant Human MTARC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MTARC1-3406H |
Product Overview : | MOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_073583) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles. As a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. May be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. Postulated to cleave the N-OH bond of N-hydroxylated substrates in concert with electron transfer from NADH to cytochrome b5 reductase then to cytochrome b5, the ultimate electron donor that primes the active site for substrate reduction. |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MTARC1 mitochondrial amidoxime reducing component 1 [ Homo sapiens (human) ] |
Official Symbol | MTARC1 |
Synonyms | MARC1; mitochondrial amidoxime reducing component 1; MARC1; MOSC1; mitochondrial amidoxime-reducing component 1; MOCO sulphurase C-terminal domain containing 1; MOSC domain-containing protein 1, mitochondrial; moco sulfurase C-terminal domain-containing protein 1; molybdenum cofactor sulfurase C-terminal domain-containing protein 1 |
Gene ID | 64757 |
mRNA Refseq | NM_022746 |
Protein Refseq | NP_073583 |
MIM | 614126 |
UniProt ID | Q5VT66 |
◆ Recombinant Proteins | ||
MTARC1-3787H | Recombinant Human MTARC1 Protein (Arg41-Leu335), N-His tagged | +Inquiry |
Mtarc1-3954M | Recombinant Mouse Mtarc1 Protein, Myc/DDK-tagged | +Inquiry |
MTARC1-3406H | Recombinant Human MTARC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTARC1-346HFL | Recombinant Full Length Human MTARC1 Protein, C-Flag-tagged | +Inquiry |
MTARC1-01H | Recombinant Human MTARC1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTARC1 Products
Required fields are marked with *
My Review for All MTARC1 Products
Required fields are marked with *