Recombinant Human MTCH1 protein, His-tagged

• Cat.No.: MTCH1-5643H
• Product Overview: Recombinant Human MTCH1 protein(123-231 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 123-231 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: VDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHRLHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MTCH1 mitochondrial carrier 1 [ Homo sapiens ]
• Official Symbol: MTCH1
• Synonyms: MTCH1; mitochondrial carrier 1; mitochondrial carrier homolog 1 (C. elegans); mitochondrial carrier homolog 1; CGI 64; PSAP; SLC25A49; solute carrier family 25; member 49; presenilin-associated protein; solute carrier family 25, member 49; cell proliferation-inducing protein 60; PIG60; CGI-64; MGC131998
• Gene ID: 23787
• mRNA Refseq: NM_014341
• Protein Refseq: NP_055156
• MIM: 610449
• UniProt ID: Q9NZJ7