Recombinant Human MTCH1 protein, His-tagged
Cat.No. : | MTCH1-5643H |
Product Overview : | Recombinant Human MTCH1 protein(123-231 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 123-231 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | VDGKIGLFRGLSPRLMSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHRLHVISMRCMVQFVGREAKYSGVLSSIGKIFKEEGLL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MTCH1 mitochondrial carrier 1 [ Homo sapiens ] |
Official Symbol | MTCH1 |
Synonyms | MTCH1; mitochondrial carrier 1; mitochondrial carrier homolog 1 (C. elegans); mitochondrial carrier homolog 1; CGI 64; PSAP; SLC25A49; solute carrier family 25; member 49; presenilin-associated protein; solute carrier family 25, member 49; cell proliferation-inducing protein 60; PIG60; CGI-64; MGC131998; |
Gene ID | 23787 |
mRNA Refseq | NM_014341 |
Protein Refseq | NP_055156 |
MIM | 610449 |
UniProt ID | Q9NZJ7 |
◆ Recombinant Proteins | ||
MTCH1-5643H | Recombinant Human MTCH1 protein, His-tagged | +Inquiry |
MTCH1-185H | Recombinant Human MTCH1 protein, GST-tagged | +Inquiry |
RFL34450HF | Recombinant Full Length Human Mitochondrial Carrier Homolog 1(Mtch1) Protein, His-Tagged | +Inquiry |
RFL27405MF | Recombinant Full Length Mouse Mitochondrial Carrier Homolog 1(Mtch1) Protein, His-Tagged | +Inquiry |
MTCH1-5768M | Recombinant Mouse MTCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTCH1-4090HCL | Recombinant Human MTCH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTCH1 Products
Required fields are marked with *
My Review for All MTCH1 Products
Required fields are marked with *
0
Inquiry Basket