Recombinant Human MTHFD1L Protein, GST-tagged

Cat.No. : MTHFD1L-5703H
Product Overview : Human MTHFD1L full-length ORF ( AAH08629.1, 1 a.a. - 366 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : One-carbon substituted forms of tetrahydrofolate (THF) are involved in the de novo synthesis of purines and thymidylate and support cellular methylation reactions through the regeneration of methionine from homocysteine. MTHFD1L is an enzyme involved in THF synthesis in mitochondria (Christensen et al., 2005 [PubMed 15611115]).[supplied by OMIM
Molecular Mass : 65.6 kDa
AA Sequence : MAVLALTDSLADMKARLGRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTHFD1L methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like [ Homo sapiens ]
Official Symbol MTHFD1L
Synonyms MTHFD1L; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like; formyltetrahydrofolate synthetase domain containing 1 , FTHFSDC1; monofunctional C1-tetrahydrofolate synthase, mitochondrial; 10 formyl THF synthetase; DKFZP586G1517; FLJ21145; mitochondrial C1 tetrahydrofolate synthase; monofunctional C1 tetrahydrofolate synthase; mitochondrial; 10-formyl-THF synthetase; formyltetrahydrofolate synthetase domain containing 1; FTHFSDC1; MTC1THFS; dJ292B18.2; RP1-292B18.2; DKFZp586G1517;
Gene ID 25902
mRNA Refseq NM_001242767
Protein Refseq NP_001229696
MIM 611427
UniProt ID Q6UB35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTHFD1L Products

Required fields are marked with *

My Review for All MTHFD1L Products

Required fields are marked with *

0
cart-icon