Recombinant Human MTHFD2 protein, T7-tagged
Cat.No. : | MTHFD2-136H |
Product Overview : | Recombinant human MTHFD2 (30 – 350aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 30-350 a.a. |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFGSRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSII LVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGI APEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPG GDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFEAV KKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ] |
Official Symbol | MTHFD2 |
Synonyms | MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase; NMDMC; |
Gene ID | 10797 |
mRNA Refseq | NM_006636 |
Protein Refseq | NP_006627 |
MIM | 604887 |
UniProt ID | P13995 |
Chromosome Location | 2p13.1 |
Pathway | C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem; |
Function | hydrolase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity; methylenetetrahydrofolate dehydrogenase (NAD+) activity; methylenetetrahydrofolate dehydrogenase (NADP+) activity; methylenetetrahydrofolate dehydrogenase (NADP+) |
◆ Recombinant Proteins | ||
MTHFD2-400Z | Recombinant Zebrafish MTHFD2 | +Inquiry |
MTHFD2-5322H | Recombinant Human MTHFD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTHFD2-5010HFL | Recombinant Full Length Human MTHFD2, Flag-tagged | +Inquiry |
MTHFD2-394H | Recombinant Human MTHFD2, MYC/DDK-tagged | +Inquiry |
MTHFD2-571H | Recombinant Human MTHFD2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
MTHFD2-4083HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFD2 Products
Required fields are marked with *
My Review for All MTHFD2 Products
Required fields are marked with *