"MTHFD2" Related Products

Expand
Expand
Expand

Recombinant Human MTHFD2 protein, T7-tagged

Cat.No. : MTHFD2-136H
Product Overview : Recombinant human MTHFD2 (30 – 350aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSII LVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGI APEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPG GDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFEAV KKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ]
Official Symbol : MTHFD2
Synonyms : MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase; NMDMC;
Gene ID : 10797
mRNA Refseq : NM_006636
Protein Refseq : NP_006627
MIM : 604887
UniProt ID : P13995
Chromosome Location : 2p13.1
Pathway : C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem;
Function : hydrolase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity; methylenetetrahydrofolate dehydrogenase (NAD+) activity; methylenetetrahydrofolate dehydrogenase (NADP+) activity; methylenetetrahydrofolate dehydrogenase (NADP+)

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.