Recombinant Human MTHFD2 protein, T7-tagged
| Cat.No. : | MTHFD2-136H |
| Product Overview : | Recombinant human MTHFD2 (30 – 350aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 30-350 a.a. |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFGSRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSII LVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGI APEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPG GDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFEAV KKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ] |
| Official Symbol | MTHFD2 |
| Synonyms | MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase; NMDMC; |
| Gene ID | 10797 |
| mRNA Refseq | NM_006636 |
| Protein Refseq | NP_006627 |
| MIM | 604887 |
| UniProt ID | P13995 |
| Chromosome Location | 2p13.1 |
| Pathway | C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; One Carbon Metabolism, organism-specific biosystem; One carbon pool by folate, organism-specific biosystem; One carbon pool by folate, conserved biosystem; |
| Function | hydrolase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity; methylenetetrahydrofolate dehydrogenase (NAD+) activity; methylenetetrahydrofolate dehydrogenase (NADP+) activity; methylenetetrahydrofolate dehydrogenase (NADP+) |
| ◆ Recombinant Proteins | ||
| MTHFD2-1868B | Recombinant Bovine MTHFD2 Protein (36-350 aa), His-SUMO-tagged | +Inquiry |
| MTHFD2-5010HFL | Recombinant Full Length Human MTHFD2, Flag-tagged | +Inquiry |
| MTHFD2-394H | Recombinant Human MTHFD2, MYC/DDK-tagged | +Inquiry |
| Mthfd2-4210M | Recombinant Mouse Mthfd2 Protein, Myc/DDK-tagged | +Inquiry |
| MTHFD2-5779M | Recombinant Mouse MTHFD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTHFD2-4083HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
| MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFD2 Products
Required fields are marked with *
My Review for All MTHFD2 Products
Required fields are marked with *



