Recombinant Bovine MTHFD2 Protein (36-350 aa), His-SUMO-tagged
Cat.No. : | MTHFD2-1868B |
Product Overview : | Recombinant Bovine MTHFD2 Protein (36-350 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 36-350 aa |
Description : | 5,10-methylenetetrahydrofolate + NAD+ = 5,10-methenyltetrahydrofolate + NADH. 5,10-methenyltetrahydrofolate + H2O = 10-formyltetrahydrofolate. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 49.9 kDa |
AA Sequence : | EAVVISGRKLAEQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEELKKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Bos taurus (cattle) ] |
Official Symbol | MTHFD2 |
Synonyms | MTHFD2; NAD-dependent methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate cyclohydrolase; |
Gene ID | 517539 |
mRNA Refseq | NM_001075755 |
Protein Refseq | NP_001069223 |
UniProt ID | Q0P5C2 |
◆ Recombinant Proteins | ||
MTHFD2-395H | Recombinant Human MTHFD2, GST-tagged | +Inquiry |
MTHFD2-5779M | Recombinant Mouse MTHFD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFD2-10192M | Recombinant Mouse MTHFD2 Protein | +Inquiry |
MTHFD2-1868B | Recombinant Bovine MTHFD2 Protein (36-350 aa), His-SUMO-tagged | +Inquiry |
MTHFD2-571H | Recombinant Human MTHFD2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFD2-4083HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTHFD2 Products
Required fields are marked with *
My Review for All MTHFD2 Products
Required fields are marked with *
0
Inquiry Basket