Recombinant Bovine MTHFD2 Protein (36-350 aa), His-SUMO-tagged
| Cat.No. : | MTHFD2-1868B |
| Product Overview : | Recombinant Bovine MTHFD2 Protein (36-350 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 36-350 aa |
| Description : | 5,10-methylenetetrahydrofolate + NAD+ = 5,10-methenyltetrahydrofolate + NADH. 5,10-methenyltetrahydrofolate + H2O = 10-formyltetrahydrofolate. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 49.9 kDa |
| AA Sequence : | EAVVISGRKLAEQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEELKKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Bos taurus (cattle) ] |
| Official Symbol | MTHFD2 |
| Synonyms | MTHFD2; NAD-dependent methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate cyclohydrolase; |
| Gene ID | 517539 |
| mRNA Refseq | NM_001075755 |
| Protein Refseq | NP_001069223 |
| UniProt ID | Q0P5C2 |
| ◆ Recombinant Proteins | ||
| MTHFD2-22H | Recombinant Human MTHFD2 protein, his-tagged | +Inquiry |
| MTHFD2-394H | Recombinant Human MTHFD2, MYC/DDK-tagged | +Inquiry |
| MTHFD2-400Z | Recombinant Zebrafish MTHFD2 | +Inquiry |
| MTHFD2-3013C | Recombinant Chicken MTHFD2 | +Inquiry |
| Mthfd2-4210M | Recombinant Mouse Mthfd2 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTHFD2-4083HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
| MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFD2 Products
Required fields are marked with *
My Review for All MTHFD2 Products
Required fields are marked with *
