"MTR" Related Products

Expand
Expand

Recombinant Human MTR Protein, GST-tagged

Cat.No.: MTR-5731H
Product Overview: Human MTR partial ORF ( NP_000245, 1094 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal.
Description: MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 37.84 kDa
AA Sequence: RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MTR 5-methyltetrahydrofolate-homocysteine methyltransferase [ Homo sapiens ]
Official Symbol: MTR
Synonyms: MTR; 5-methyltetrahydrofolate-homocysteine methyltransferase; methionine synthase; cblG; cobalamin-dependent methionine synthase; vitamin-B12 dependent methionine synthase; 5-methyltetrahydrofolate-homocysteine methyltransferase 1; MS; FLJ33168; FLJ43216; FLJ45386;
Gene ID: 4548
mRNA Refseq: NM_000254
Protein Refseq: NP_000245
MIM: 156570
UniProt ID: Q99707

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.