Recombinant Human MTR Protein, GST-tagged

Cat.No. : MTR-5731H
Product Overview : Human MTR partial ORF ( NP_000245, 1094 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTR 5-methyltetrahydrofolate-homocysteine methyltransferase [ Homo sapiens ]
Official Symbol MTR
Synonyms MTR; 5-methyltetrahydrofolate-homocysteine methyltransferase; methionine synthase; cblG; cobalamin-dependent methionine synthase; vitamin-B12 dependent methionine synthase; 5-methyltetrahydrofolate-homocysteine methyltransferase 1; MS; FLJ33168; FLJ43216; FLJ45386;
Gene ID 4548
mRNA Refseq NM_000254
Protein Refseq NP_000245
MIM 156570
UniProt ID Q99707

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTR Products

Required fields are marked with *

My Review for All MTR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon