Recombinant Human MTR Protein, GST-tagged
| Cat.No. : | MTR-5731H |
| Product Overview : | Human MTR partial ORF ( NP_000245, 1094 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MTR 5-methyltetrahydrofolate-homocysteine methyltransferase [ Homo sapiens ] |
| Official Symbol | MTR |
| Synonyms | MTR; 5-methyltetrahydrofolate-homocysteine methyltransferase; methionine synthase; cblG; cobalamin-dependent methionine synthase; vitamin-B12 dependent methionine synthase; 5-methyltetrahydrofolate-homocysteine methyltransferase 1; MS; FLJ33168; FLJ43216; FLJ45386; |
| Gene ID | 4548 |
| mRNA Refseq | NM_000254 |
| Protein Refseq | NP_000245 |
| MIM | 156570 |
| UniProt ID | Q99707 |
| ◆ Recombinant Proteins | ||
| MTR-3817R | Recombinant Rat MTR Protein | +Inquiry |
| MTR-2288M | Recombinant Mycobacterium Tuberculosis MTR Protein (1-459 aa), His-SUMO-Myc-tagged | +Inquiry |
| Mtr-1799M | Recombinant Mouse Mtr Protein, His-tagged | +Inquiry |
| MTR-4759H | Recombinant Human MTR protein, His-SUMO-tagged | +Inquiry |
| MTR-1704H | Recombinant Human MTR Protein (923-1265 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTR Products
Required fields are marked with *
My Review for All MTR Products
Required fields are marked with *




