Cat.No.:	MTR-5731H
Product Overview:	Human MTR partial ORF ( NP_000245, 1094 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal.
Description:	MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. [provided by RefSeq
Source:	Wheat Germ
Species:	Human
Tag :	GST
Molecular Mass:	37.84 kDa
AA Sequence:	RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
Applications:	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes:	Best use within three months from the date of receipt of this protein.
Storage:	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name:	MTR 5-methyltetrahydrofolate-homocysteine methyltransferase [ Homo sapiens ]
Official Symbol:	MTR
Synonyms:	MTR; 5-methyltetrahydrofolate-homocysteine methyltransferase; methionine synthase; cblG; cobalamin-dependent methionine synthase; vitamin-B12 dependent methionine synthase; 5-methyltetrahydrofolate-homocysteine methyltransferase 1; MS; FLJ33168; FLJ43216; FLJ45386;
Gene ID:	4548
mRNA Refseq:	NM_000254
Protein Refseq:	NP_000245
MIM:	156570
UniProt ID:	Q99707

Online Inquiry