Recombinant Human MTR Protein, GST-tagged

• Cat.No.: MTR-5731H
• Product Overview: Human MTR partial ORF ( NP_000245, 1094 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: RDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTR 5-methyltetrahydrofolate-homocysteine methyltransferase [ Homo sapiens ]
• Official Symbol: MTR
• Synonyms: MTR; 5-methyltetrahydrofolate-homocysteine methyltransferase; methionine synthase; cblG; cobalamin-dependent methionine synthase; vitamin-B12 dependent methionine synthase; 5-methyltetrahydrofolate-homocysteine methyltransferase 1; MS; FLJ33168; FLJ43216; FLJ45386
• Gene ID: 4548
• mRNA Refseq: NM_000254
• Protein Refseq: NP_000245
• MIM: 156570
• UniProt ID: Q99707