Recombinant Human MUC12 Protein, GST-tagged
| Cat.No. : | MUC12-5746H |
| Product Overview : | Human MUC12 partial ORF ( XP_379904.2, 391 a.a. - 465 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an integral membrane glycoprotein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces and have been implicated in epithelial renewal and differentiation. These glycoproteins also play a role in intracellular signaling. This protein is expressed on the apical membrane surface of epithelial cells that line the mucosal surfaces of many different tissues including the colon, pancreas, prostate, and uterus. The expression of this gene is downregulated in colorectal cancer tissue. [provided by RefSeq, Apr 2017] |
| Molecular Mass : | 33.99 kDa |
| AA Sequence : | SQRKRHREQYDVPQEWRKEGTPGIFQKTAIWEDQNLRESRFGLENAYNNFRPTLETVDSGTELHIQRPEMVASTV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MUC12 mucin 12, cell surface associated [ Homo sapiens (human) ] |
| Official Symbol | MUC12 |
| Synonyms | MUC12; mucin 12, cell surface associated; MUC11; MUC-11; MUC-12; mucin-12; mucin-11 |
| Gene ID | 10071 |
| mRNA Refseq | NM_001164462 |
| Protein Refseq | NP_001157934 |
| MIM | 604609 |
| UniProt ID | Q9UKN1 |
| ◆ Recombinant Proteins | ||
| MUC12-707H | Recombinant Human MUC12 | +Inquiry |
| MUC12-2461H | Recombinant Human MUC12 Protein, His-tagged | +Inquiry |
| MUC12-5746H | Recombinant Human MUC12 Protein, GST-tagged | +Inquiry |
| MUC12-3543H | Recombinant Human MUC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC12 Products
Required fields are marked with *
My Review for All MUC12 Products
Required fields are marked with *
