Recombinant Human MYC protein, His-GST-tagged
| Cat.No. : | MYC-3258H |
| Product Overview : | Recombinant Human MYC protein(P01106)(169-439aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 169-439aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 61.7 kDa |
| AA Sequence : | SVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | MYC v-myc myelocytomatosis viral oncogene homolog (avian) [ Homo sapiens ] |
| Official Symbol | MYC |
| Synonyms | MYC; v-myc myelocytomatosis viral oncogene homolog (avian); v myc avian myelocytomatosis viral oncogene homolog; myc proto-oncogene protein; bHLHe39; c Myc; proto-oncogene c-Myc; transcription factor p64; class E basic helix-loop-helix protein 39; avian myelocytomatosis viral oncogene homolog; v-myc avian myelocytomatosis viral oncogene homolog; myc-related translation/localization regulatory factor; MRTL; c-Myc; |
| Gene ID | 4609 |
| mRNA Refseq | NM_002467 |
| Protein Refseq | NP_002458 |
| MIM | 190080 |
| UniProt ID | P01106 |
| ◆ Recombinant Proteins | ||
| MYC-5787H | Recombinant Human MYC Protein, GST-tagged | +Inquiry |
| MYC-3627H | Recombinant Human MYC protein, 11R-tagged | +Inquiry |
| MYC-1461H | Recombinant Human MYC Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYC-2522H | Active Recombinant Human MYC, His-tagged | +Inquiry |
| MYC-574H | Recombinant Human MYC protein, His & GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MYC-05H | Recombinant Human MYC Protein, Biotin labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYC-4039HCL | Recombinant Human MYC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYC Products
Required fields are marked with *
My Review for All MYC Products
Required fields are marked with *
