Recombinant Human MYCL1 Protein, GST-tagged
Cat.No. : | MYCL1-5791H |
Product Overview : | Human MYCL1 full-length ORF ( NP_005367.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYCL (MYCL Proto-Oncogene, BHLH Transcription Factor) is a Protein Coding gene. Diseases associated with MYCL include Apocrine Adenosis Of Breast and Lower Lip Cancer. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is MYCN. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYCL1 v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) [ Homo sapiens ] |
Official Symbol | MYCL1 |
Synonyms | MYCL1; v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian); MYCL, v myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived; protein L-Myc-1; bHLHe38; l myc protein; LMYC; myc related gene from lung cancer; oncogene lmyc; l-myc-1 proto-oncogene; myc-related gene from lung cancer; class E basic helix-loop-helix protein 38; MYCL; |
Gene ID | 4610 |
mRNA Refseq | NM_001033081 |
Protein Refseq | NP_001028253 |
MIM | 164850 |
UniProt ID | P12524 |
◆ Recombinant Proteins | ||
MYCL1-5831M | Recombinant Mouse MYCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYCL1-10289M | Recombinant Mouse MYCL1 Protein | +Inquiry |
MYCL1-5791H | Recombinant Human MYCL1 Protein, GST-tagged | +Inquiry |
MYCL1-1127H | Recombinant Human MYCL1 protein, His-tagged | +Inquiry |
MYCL1-7843H | Recombinant Human MYCL1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYCL1-4037HCL | Recombinant Human MYCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCL1 Products
Required fields are marked with *
My Review for All MYCL1 Products
Required fields are marked with *
0
Inquiry Basket