Recombinant Human MYCL1 Protein, GST-tagged

Cat.No. : MYCL1-5791H
Product Overview : Human MYCL1 full-length ORF ( NP_005367.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MYCL (MYCL Proto-Oncogene, BHLH Transcription Factor) is a Protein Coding gene. Diseases associated with MYCL include Apocrine Adenosis Of Breast and Lower Lip Cancer. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is MYCN.
Molecular Mass : 48.2 kDa
AA Sequence : MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYCL1 v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) [ Homo sapiens ]
Official Symbol MYCL1
Synonyms MYCL1; v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian); MYCL, v myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived; protein L-Myc-1; bHLHe38; l myc protein; LMYC; myc related gene from lung cancer; oncogene lmyc; l-myc-1 proto-oncogene; myc-related gene from lung cancer; class E basic helix-loop-helix protein 38; MYCL;
Gene ID 4610
mRNA Refseq NM_001033081
Protein Refseq NP_001028253
MIM 164850
UniProt ID P12524

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYCL1 Products

Required fields are marked with *

My Review for All MYCL1 Products

Required fields are marked with *

0
cart-icon