Recombinant Human MYD88
| Cat.No. : | MYD88-29151TH |
| Product Overview : | Recombinant fragment corressponding to amino acids 31-130 of Human MyD88 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ |
| Sequence Similarities : | Contains 1 death domain.Contains 1 TIR domain. |
| Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ] |
| Official Symbol | MYD88 |
| Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; |
| Gene ID | 4615 |
| mRNA Refseq | NM_001172566 |
| Protein Refseq | NP_001166037 |
| MIM | 602170 |
| Uniprot ID | Q99836 |
| Chromosome Location | 3p22 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; |
| Function | TIR domain binding; Toll binding; death receptor binding; identical protein binding; protein binding; |
| ◆ Recombinant Proteins | ||
| MYD88-4760H | Recombinant Human MYD88 protein, His-tagged | +Inquiry |
| MYD88-7112H | Recombinant Human MYD88, His-tagged | +Inquiry |
| MYD88-30H | Recombinant Human MYD88 protein, MYC/DDK-tagged | +Inquiry |
| MYD88-5796H | Recombinant Human MYD88 Protein, GST-tagged | +Inquiry |
| MYD88-0071H | Recombinant Human MYD88 Protein (M157-P296), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *
