Recombinant Human MYD88

Cat.No. : MYD88-29151TH
Product Overview : Recombinant fragment corressponding to amino acids 31-130 of Human MyD88 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ
Sequence Similarities : Contains 1 death domain.Contains 1 TIR domain.
Gene Name MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ]
Official Symbol MYD88
Synonyms MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88;
Gene ID 4615
mRNA Refseq NM_001172566
Protein Refseq NP_001166037
MIM 602170
Uniprot ID Q99836
Chromosome Location 3p22
Pathway Activated TLR4 signalling, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem;
Function TIR domain binding; Toll binding; death receptor binding; identical protein binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYD88 Products

Required fields are marked with *

My Review for All MYD88 Products

Required fields are marked with *

0
cart-icon