Recombinant Human MYD88 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | MYD88-272H |
Product Overview : | MYD88 MS Standard C13 and N15-labeled recombinant protein (NP_002459) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
Molecular Mass : | 33.2 kDa |
AA Sequence : | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens (human) ] |
Official Symbol | MYD88 |
Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D; |
Gene ID | 4615 |
mRNA Refseq | NM_002468 |
Protein Refseq | NP_002459 |
MIM | 602170 |
UniProt ID | Q99836 |
◆ Recombinant Proteins | ||
MYD88-12080Z | Recombinant Zebrafish MYD88 | +Inquiry |
Myd88-1827M | Recombinant Mouse Myd88 protein, His-tagged | +Inquiry |
MYD88-10293M | Recombinant Mouse MYD88 Protein | +Inquiry |
MYD88-0071H | Recombinant Human MYD88 Protein (M157-P296), Tag Free | +Inquiry |
MYD88-6731HF | Recombinant Full Length Human MYD88 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *
0
Inquiry Basket