Recombinant Human MYF6 protein, GST-tagged
Cat.No. : | MYF6-6743H |
Product Overview : | Recombinant Human MYF6 protein(1-242 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-242 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MYF6 myogenic factor 6 (herculin) [ Homo sapiens ] |
Official Symbol | MYF6 |
Synonyms | MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4; muscle-specific regulatory factor 4; class C basic helix-loop-helix protein 4; CNM3; myf-6; |
Gene ID | 4618 |
mRNA Refseq | NM_002469 |
Protein Refseq | NP_002460 |
MIM | 159991 |
UniProt ID | P23409 |
◆ Recombinant Proteins | ||
MYF6-2447C | Recombinant Chicken MYF6 | +Inquiry |
MYF6-6743H | Recombinant Human MYF6 protein, GST-tagged | +Inquiry |
MYF6-3844R | Recombinant Rat MYF6 Protein | +Inquiry |
MYF6-29361TH | Recombinant Human MYF6 | +Inquiry |
MYF6-10297M | Recombinant Mouse MYF6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYF6-4033HCL | Recombinant Human MYF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYF6 Products
Required fields are marked with *
My Review for All MYF6 Products
Required fields are marked with *