Recombinant Human MYL12A, His-tagged
Cat.No. : | MYL12A-28634TH |
Product Overview : | Recombinant full length Human MRCL3 (amino acids 1-171) with a N terminal His tag. 195 amino acids with a predicted MWt 22.4 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 171 amino acids |
Description : | Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. |
Conjugation : | HIS |
Molecular Weight : | 22.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMSSKRTKTKTKKRPQR ATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLH DMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLN GTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDR FTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
Sequence Similarities : | Contains 3 EF-hand domains. |
Gene Name | MYL12A myosin, light chain 12A, regulatory, non-sarcomeric [ Homo sapiens ] |
Official Symbol | MYL12A |
Synonyms | MYL12A; myosin, light chain 12A, regulatory, non-sarcomeric; myosin, light polypeptide, regulatory, non sarcomeric (20kD); myosin regulatory light chain 12A; MLCB; MRCL3; MRLC3; MYL2B; myosin regulatory light chain 3; |
Gene ID | 10627 |
mRNA Refseq | NM_006471 |
Protein Refseq | NP_006462 |
Uniprot ID | P19105 |
Chromosome Location | 18p11.31 |
Pathway | Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function | calcium ion binding; glutamate receptor binding; |
◆ Recombinant Proteins | ||
MYL12A-4844H | Recombinant Human MYL12A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYL12A-843H | Recombinant Human MYL12A protein, His-tagged | +Inquiry |
MYL12A-28634TH | Recombinant Human MYL12A, His-tagged | +Inquiry |
MYL12A-5536H | Recombinant Human MYL12A Protein, His-tagged | +Inquiry |
MYL12A-3511R | Recombinant Rat MYL12A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL12A-4030HCL | Recombinant Human MYL12A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL12A Products
Required fields are marked with *
My Review for All MYL12A Products
Required fields are marked with *