Recombinant Human MYL12B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MYL12B-3637H |
Product Overview : | MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The activity of nonmuscle myosin II (see MYH9) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments. |
Molecular Mass : | 17.6 kDa |
AA Sequence : | MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MYL12B myosin light chain 12B [ Homo sapiens (human) ] |
Official Symbol | MYL12B |
Synonyms | MYL12B; myosin, light chain 12B, regulatory; myosin regulatory light chain 12B; MRLC2; myosin regulatory light chain 2; MLC-2; MLC20; MLC-2A; SHUJUN-1; myosin regulatory light chain MRLC2; myosin regulatory light chain 20 kDa; myosin regulatory light chain 2-B, smooth muscle isoform; MLC-B; |
Gene ID | 103910 |
mRNA Refseq | NM_001144946 |
Protein Refseq | NP_001138418 |
MIM | 609211 |
UniProt ID | O14950 |
◆ Recombinant Proteins | ||
MYL12B-1263H | Recombinant Human MYL12B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Myl12b-4249M | Recombinant Mouse Myl12b Protein, Myc/DDK-tagged | +Inquiry |
MYL12B-10313M | Recombinant Mouse MYL12B Protein | +Inquiry |
MYL12B-2277H | Recombinant Human MYL12B Protein, MYC/DDK-tagged | +Inquiry |
MYL12B-2922R | Recombinant Rhesus monkey MYL12B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL12B-4029HCL | Recombinant Human MYL12B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL12B Products
Required fields are marked with *
My Review for All MYL12B Products
Required fields are marked with *