Recombinant Human MYL12B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MYL12B-3637H
Product Overview : MYL12B MS Standard C13 and N15-labeled recombinant protein (NP_001138418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The activity of nonmuscle myosin II (see MYH9) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments.
Molecular Mass : 17.6 kDa
AA Sequence : MSSMFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MYL12B myosin light chain 12B [ Homo sapiens (human) ]
Official Symbol MYL12B
Synonyms MYL12B; myosin, light chain 12B, regulatory; myosin regulatory light chain 12B; MRLC2; myosin regulatory light chain 2; MLC-2; MLC20; MLC-2A; SHUJUN-1; myosin regulatory light chain MRLC2; myosin regulatory light chain 20 kDa; myosin regulatory light chain 2-B, smooth muscle isoform; MLC-B;
Gene ID 103910
mRNA Refseq NM_001144946
Protein Refseq NP_001138418
MIM 609211
UniProt ID O14950

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYL12B Products

Required fields are marked with *

My Review for All MYL12B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon