Recombinant Human MYL6, His-tagged
| Cat.No. : | MYL6-30266TH |
| Product Overview : | Recombinant full length Human MYL6 with an N terminal His tag; 171 amino acids with a predicted MWt 19.1 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 151 amino acids |
| Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 19.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEELVRMVLNG |
| Sequence Similarities : | Contains 3 EF-hand domains. |
| Gene Name | MYL6 myosin, light chain 6, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
| Official Symbol | MYL6 |
| Synonyms | MYL6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non muscle; myosin light polypeptide 6; ESMLC; MLC1SM; MLC3NM; |
| Gene ID | 4637 |
| mRNA Refseq | NM_021019 |
| Protein Refseq | NP_066299 |
| MIM | 609931 |
| Uniprot ID | P60660 |
| Chromosome Location | 12q13.13 |
| Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Muscle contraction, organism-specific biosystem; Sema4D in semaphorin signaling, organism-specific biosystem; |
| Function | actin-dependent ATPase activity; calcium ion binding; motor activity; protein binding; structural constituent of muscle; |
| ◆ Recombinant Proteins | ||
| MYL6-3441H | Recombinant Human MYL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYL6-30266TH | Recombinant Human MYL6, His-tagged | +Inquiry |
| MYL6-2742R | Recombinant Rhesus Macaque MYL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYL6-10317M | Recombinant Mouse MYL6 Protein | +Inquiry |
| Myl6-4253M | Recombinant Mouse Myl6 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYL6-4024HCL | Recombinant Human MYL6 293 Cell Lysate | +Inquiry |
| MYL6-4023HCL | Recombinant Human MYL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL6 Products
Required fields are marked with *
My Review for All MYL6 Products
Required fields are marked with *



