Recombinant Human MYLPF Protein, GST-tagged

• Cat.No.: MYLPF-5827H
• Product Overview: Human MYLPF full-length ORF ( AAH12571, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MYLPF (Myosin Light Chain, Phosphorylatable, Fast Skeletal Muscle) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include calcium ion binding and structural constituent of muscle. An important paralog of this gene is MYL10.
• Molecular Mass: 44.33 kDa
• AA Sequence: MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ]
• Official Symbol: MYLPF
• Synonyms: MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; MLC2B; myosin light chain 2; fast skeletal myosin light chain 2; myosin, light chain 11, regulatory; MGC13450; DKFZp779C0757
• Gene ID: 29895
• mRNA Refseq: NM_013292
• Protein Refseq: NP_037424
• UniProt ID: Q96A32