Recombinant Human MYLPF Protein, GST-tagged
Cat.No. : | MYLPF-5827H |
Product Overview : | Human MYLPF full-length ORF ( AAH12571, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYLPF (Myosin Light Chain, Phosphorylatable, Fast Skeletal Muscle) is a Protein Coding gene. Among its related pathways are Focal Adhesion and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include calcium ion binding and structural constituent of muscle. An important paralog of this gene is MYL10. |
Molecular Mass : | 44.33 kDa |
AA Sequence : | MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYLPF myosin light chain, phosphorylatable, fast skeletal muscle [ Homo sapiens ] |
Official Symbol | MYLPF |
Synonyms | MYLPF; myosin light chain, phosphorylatable, fast skeletal muscle; myosin regulatory light chain 2, skeletal muscle isoform; HUMMLC2B; MRLC2; MYL11; myosin regulatory light chain 2; myosin; light chain 11; regulatory; MLC2B; myosin light chain 2; fast skeletal myosin light chain 2; myosin, light chain 11, regulatory; MGC13450; DKFZp779C0757; |
Gene ID | 29895 |
mRNA Refseq | NM_013292 |
Protein Refseq | NP_037424 |
UniProt ID | Q96A32 |
◆ Recombinant Proteins | ||
MYLPF-10325M | Recombinant Mouse MYLPF Protein | +Inquiry |
MYLPF-5827H | Recombinant Human MYLPF Protein, GST-tagged | +Inquiry |
Mylpf-4259M | Recombinant Mouse Mylpf Protein, Myc/DDK-tagged | +Inquiry |
MYLPF-574H | Active Recombinant Human MYLPF | +Inquiry |
MYLPF-30271TH | Recombinant Human MYLPF, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYLPF-4013HCL | Recombinant Human MYLPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYLPF Products
Required fields are marked with *
My Review for All MYLPF Products
Required fields are marked with *