Recombinant Human MYO1B Protein, GST-tagged

Cat.No. : MYO1B-5831H
Product Overview : Human MYO1B partial ORF ( NP_036355, 979 a.a. - 1078 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MYO1B (Myosin IB) is a Protein Coding gene. Diseases associated with MYO1B include Glass Syndrome and Amebiasis. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include calmodulin binding and motor activity. An important paralog of this gene is MYO1A.
Molecular Mass : 36.74 kDa
AA Sequence : VSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO1B myosin IB [ Homo sapiens (human) ]
Official Symbol MYO1B
Synonyms MYO1B; myosin IB; MMIa; myr1; MYH-1c; MMI-alpha; unconventional myosin-Ib; MYO1B variant protein; myosin-I alpha
Gene ID 4430
mRNA Refseq NM_001130158
Protein Refseq NP_001123630
MIM 606537
UniProt ID O43795

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO1B Products

Required fields are marked with *

My Review for All MYO1B Products

Required fields are marked with *

0
cart-icon