Recombinant Human MYO1B Protein, GST-tagged
Cat.No. : | MYO1B-5831H |
Product Overview : | Human MYO1B partial ORF ( NP_036355, 979 a.a. - 1078 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYO1B (Myosin IB) is a Protein Coding gene. Diseases associated with MYO1B include Glass Syndrome and Amebiasis. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include calmodulin binding and motor activity. An important paralog of this gene is MYO1A. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYO1B myosin IB [ Homo sapiens (human) ] |
Official Symbol | MYO1B |
Synonyms | MYO1B; myosin IB; MMIa; myr1; MYH-1c; MMI-alpha; unconventional myosin-Ib; MYO1B variant protein; myosin-I alpha |
Gene ID | 4430 |
mRNA Refseq | NM_001130158 |
Protein Refseq | NP_001123630 |
MIM | 606537 |
UniProt ID | O43795 |
◆ Recombinant Proteins | ||
MYO1B-5831H | Recombinant Human MYO1B Protein, GST-tagged | +Inquiry |
MYO1B-2926R | Recombinant Rhesus monkey MYO1B Protein, His-tagged | +Inquiry |
Myo1b-8036M | Recombinant Mouse Myo1b protein, His-tagged | +Inquiry |
MYO1B-3862R | Recombinant Rat MYO1B Protein | +Inquiry |
MYO1B-2745R | Recombinant Rhesus Macaque MYO1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO1B Products
Required fields are marked with *
My Review for All MYO1B Products
Required fields are marked with *