Recombinant Human MYO1B Protein, GST-tagged

• Cat.No.: MYO1B-5831H
• Product Overview: Human MYO1B partial ORF ( NP_036355, 979 a.a. - 1078 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MYO1B (Myosin IB) is a Protein Coding gene. Diseases associated with MYO1B include Glass Syndrome and Amebiasis. Among its related pathways are Sertoli-Sertoli Cell Junction Dynamics and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include calmodulin binding and motor activity. An important paralog of this gene is MYO1A.
• Molecular Mass: 36.74 kDa
• AA Sequence: VSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO1B myosin IB [ Homo sapiens (human) ]
• Official Symbol: MYO1B
• Synonyms: MYO1B; myosin IB; MMIa; myr1; MYH-1c; MMI-alpha; unconventional myosin-Ib; MYO1B variant protein; myosin-I alpha
• Gene ID: 4430
• mRNA Refseq: NM_001130158
• Protein Refseq: NP_001123630
• MIM: 606537
• UniProt ID: O43795