Recombinant Human MYO6 Protein, GST-tagged

Cat.No. : MYO6-5843H
Product Overview : Human MYO6 partial ORF ( NP_004990.2, 1188 a.a. - 1285 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein involved intracellular vesicle and organelle transport, especially in the hair cell of the inner ear. Mutations in this gene have been found in patients with non-syndromic autosomal dominant and recessive hearing loss. [provided by RefSeq
Molecular Mass : 36.52 kDa
AA Sequence : KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO6 myosin VI [ Homo sapiens ]
Official Symbol MYO6
Synonyms MYO6; myosin VI; deafness, autosomal recessive 37 , DFNA22, DFNB37; unconventional myosin-VI; KIAA0389; myosin-VI; unconventional myosin-6; DFNA22; DFNB37;
Gene ID 4646
mRNA Refseq NM_004999
Protein Refseq NP_004990
MIM 600970
UniProt ID Q9UM54

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO6 Products

Required fields are marked with *

My Review for All MYO6 Products

Required fields are marked with *

0
cart-icon