Recombinant Human MYO6 Protein, GST-tagged
| Cat.No. : | MYO6-5843H |
| Product Overview : | Human MYO6 partial ORF ( NP_004990.2, 1188 a.a. - 1285 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein involved intracellular vesicle and organelle transport, especially in the hair cell of the inner ear. Mutations in this gene have been found in patients with non-syndromic autosomal dominant and recessive hearing loss. [provided by RefSeq |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | KKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIESRQARPTYATAMLQSLLK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYO6 myosin VI [ Homo sapiens ] |
| Official Symbol | MYO6 |
| Synonyms | MYO6; myosin VI; deafness, autosomal recessive 37 , DFNA22, DFNB37; unconventional myosin-VI; KIAA0389; myosin-VI; unconventional myosin-6; DFNA22; DFNB37; |
| Gene ID | 4646 |
| mRNA Refseq | NM_004999 |
| Protein Refseq | NP_004990 |
| MIM | 600970 |
| UniProt ID | Q9UM54 |
| ◆ Recombinant Proteins | ||
| MYO6-5843H | Recombinant Human MYO6 Protein, GST-tagged | +Inquiry |
| MYO6-2746R | Recombinant Rhesus Macaque MYO6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Myo6-4260M | Recombinant Mouse Myo6 Protein, Myc/DDK-tagged | +Inquiry |
| MYO6-3372H | Recombinant Human MYO6 protein, His-tagged | +Inquiry |
| MYO6-2927R | Recombinant Rhesus monkey MYO6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYO6-4006HCL | Recombinant Human MYO6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO6 Products
Required fields are marked with *
My Review for All MYO6 Products
Required fields are marked with *
