Recombinant Human MYO9B Protein, GST-tagged
Cat.No. : | MYO9B-5848H |
Product Overview : | Human MYO9B partial ORF ( AAH18108, 201 a.a. - 290 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the myosin family of actin-based molecular motor heavy chain proteins. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-9 (MYH9). The protein has four IQ motifs located in the neck domain that bind calmodulin, which serves as a light chain. The protein complex has a single-headed structure and exhibits processive movement on actin filaments toward the minus-end. The protein also has rho-GTPase activity. Polymorphisms in this gene are associated with celiac disease and ulcerative colitis susceptibility. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | CPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGFSSPYEGVLNKSPKTRDIQEEEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYO9B myosin IXB [ Homo sapiens ] |
Official Symbol | MYO9B |
Synonyms | MYO9B; myosin IXB; CELIAC4; unconventional myosin-IXb; myosin-IXb; unconventional myosin-9b; unconventional myosin IXb; MYR5; |
Gene ID | 4650 |
mRNA Refseq | NM_001130065 |
Protein Refseq | NP_001123537 |
MIM | 602129 |
UniProt ID | Q13459 |
◆ Recombinant Proteins | ||
MYO9B-2790H | Recombinant Human MYO9B protein, His-tagged | +Inquiry |
MYO9B-5848H | Recombinant Human MYO9B Protein, GST-tagged | +Inquiry |
MYO9B-1146H | Recombinant Human MYO9B, GST-tagged | +Inquiry |
MYO9B-5474C | Recombinant Chicken MYO9B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO9B Products
Required fields are marked with *
My Review for All MYO9B Products
Required fields are marked with *
0
Inquiry Basket