Recombinant Human MYOG protein, His-tagged
Cat.No. : | MYOG-3209H |
Product Overview : | Recombinant Human MYOG protein(138-224 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 138-224 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
Official Symbol | MYOG |
Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; myf-4; myogenic factor 4; Myogenic factor-4; class C basic helix-loop-helix protein 3; MYOGENIN; |
Gene ID | 4656 |
mRNA Refseq | NM_002479 |
Protein Refseq | NP_002470 |
MIM | 159980 |
UniProt ID | P15173 |
◆ Recombinant Proteins | ||
MYOG-5867M | Recombinant Mouse MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
MYOG-8637Z | Recombinant Zebrafish MYOG | +Inquiry |
Myog-1513R | Recombinant Rat Myog protein, His & T7-tagged | +Inquiry |
MYOG-5758C | Recombinant Chicken MYOG | +Inquiry |
Myog-1810M | Recombinant Mouse Myog Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *