Recombinant Human MYOG protein, His-tagged
| Cat.No. : | MYOG-3209H |
| Product Overview : | Recombinant Human MYOG protein(138-224 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 138-224 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MYOG myogenin (myogenic factor 4) [ Homo sapiens ] |
| Official Symbol | MYOG |
| Synonyms | MYOG; myogenin (myogenic factor 4); MYF4; myogenin; bHLHc3; myf-4; myogenic factor 4; Myogenic factor-4; class C basic helix-loop-helix protein 3; MYOGENIN; |
| Gene ID | 4656 |
| mRNA Refseq | NM_002479 |
| Protein Refseq | NP_002470 |
| MIM | 159980 |
| UniProt ID | P15173 |
| ◆ Recombinant Proteins | ||
| MYOG-5758C | Recombinant Chicken MYOG | +Inquiry |
| MYOG-3209H | Recombinant Human MYOG protein, His-tagged | +Inquiry |
| MYOG-5867M | Recombinant Mouse MYOG Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYOG-288H | Recombinant Human MYOG | +Inquiry |
| MYOG-5853H | Recombinant Human MYOG Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYOG-4004HCL | Recombinant Human MYOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYOG Products
Required fields are marked with *
My Review for All MYOG Products
Required fields are marked with *
