Recombinant Human MYT1 Protein (900-1101 aa), His-tagged
Cat.No. : | MYT1-1288H |
Product Overview : | Recombinant Human MYT1 Protein (900-1101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Developmental Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 900-1101 aa |
Description : | Binds to the promoter regions of proteolipid proteins of the central nervous syst. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.1 kDa |
AA Sequence : | GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | MYT1 myelin transcription factor 1 [ Homo sapiens ] |
Official Symbol | MYT1 |
Synonyms | MYT1; PLPB1; MTF1; MYTI; C20orf36; |
Gene ID | 4661 |
mRNA Refseq | NM_004535 |
Protein Refseq | NP_004526 |
MIM | 600379 |
UniProt ID | Q01538 |
◆ Recombinant Proteins | ||
MYT1-3002H | Recombinant Human MYT1 protein, His-tagged | +Inquiry |
MYT1-1156H | Recombinant Human MYT1, His-tagged | +Inquiry |
MYT1-3006H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
MYT1-3004H | Recombinant Human MYT1 Protein, GST-tagged | +Inquiry |
MYT1-1288H | Recombinant Human MYT1 Protein (900-1101 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYT1-1163HCL | Recombinant Human MYT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYT1 Products
Required fields are marked with *
My Review for All MYT1 Products
Required fields are marked with *
0
Inquiry Basket