Recombinant Human NANOS2 Protein (1-138 aa), His-SUMO-tagged
Cat.No. : | NANOS2-676H |
Product Overview : | Recombinant Human NANOS2 Protein (1-138 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-138 aa |
Description : | Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the fale fate. Represses the fale fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for preiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial st cell population. Not essential for the assbly of P-bodies but is required for the maintenance of their normal state. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 31.1 kDa |
AA Sequence : | MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NANOS2 nanos homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | NANOS2 |
Synonyms | NANOS2; nanos homolog 2; NOS2; NOS-2; |
Gene ID | 339345 |
mRNA Refseq | NM_001029861 |
Protein Refseq | NP_001025032 |
MIM | 608228 |
UniProt ID | P60321 |
◆ Recombinant Proteins | ||
NANOS2-3581H | Recombinant Human NANOS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nanos2-4286M | Recombinant Mouse Nanos2 Protein, Myc/DDK-tagged | +Inquiry |
NANOS2-676H | Recombinant Human NANOS2 Protein (1-138 aa), His-SUMO-tagged | +Inquiry |
NANOS2-878H | Recombinant Human NANOS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANOS2-2131HCL | Recombinant Human NANOS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NANOS2 Products
Required fields are marked with *
My Review for All NANOS2 Products
Required fields are marked with *
0
Inquiry Basket