Recombinant human NAT9 protein, His-tagged

Cat.No. : NAT9-1195H
Product Overview : Recombinant NAT9 protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 207
Description : This gene encodes a N-acetyltransferase enzyme that is catalyze the transfer of an acetyl group to a nitrogen atom on the acceptor molecule.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Molecular Mass : 39 kDa
AA Sequence : MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining
Storage : Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Gene Name NAT9
Official Symbol NAT9
Synonyms EBSP, hNATL
Gene ID 26151
mRNA Refseq NM_015654.5
Protein Refseq NP_056469.2
MIM 600950
UniProt ID Q9BTE0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAT9 Products

Required fields are marked with *

My Review for All NAT9 Products

Required fields are marked with *

0
cart-icon
0
compare icon