Recombinant human NAT9 protein, His-tagged
| Cat.No. : | NAT9-1195H |
| Product Overview : | Recombinant NAT9 protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 207 |
| Description : | This gene encodes a N-acetyltransferase enzyme that is catalyze the transfer of an acetyl group to a nitrogen atom on the acceptor molecule. |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| Molecular Mass : | 39 kDa |
| AA Sequence : | MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining |
| Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). |
| Gene Name | NAT9 |
| Official Symbol | NAT9 |
| Synonyms | EBSP, hNATL |
| Gene ID | 26151 |
| mRNA Refseq | NM_015654.5 |
| Protein Refseq | NP_056469.2 |
| MIM | 600950 |
| UniProt ID | Q9BTE0 |
| ◆ Recombinant Proteins | ||
| NAT9-5922M | Recombinant Mouse NAT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NAT9-1197H | Recombinant Human NAT9, GST-tagged | +Inquiry |
| NAT9-2950R | Recombinant Rhesus monkey NAT9 Protein, His-tagged | +Inquiry |
| NAT9-78H | Recombinant Human NAT9 Protein, His-tagged | +Inquiry |
| NAT9-10442M | Recombinant Mouse NAT9 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAT9-3959HCL | Recombinant Human NAT9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT9 Products
Required fields are marked with *
My Review for All NAT9 Products
Required fields are marked with *
