Recombinant Human NAT9 Protein, His-tagged
Cat.No. : | NAT9-78H |
Product Overview : | Recombinant Human NAT9 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Predicted to enable N-acetyltransferase activity. Predicted to be involved in protein acetylation. Part of protein-containing complex. |
Form : | Supplied as a 0.2 μm filtered solution in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.0). |
Molecular Mass : | ~24.4 kDa |
AA Sequence : | MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPCLEHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.9mg/mL |
Gene Name | NAT9 N-acetyltransferase 9 (putative) [ Homo sapiens (human) ] |
Official Symbol | NAT9 |
Synonyms | EBSP, hNATL |
Gene ID | 26151 |
mRNA Refseq | NM_001305077 |
Protein Refseq | NP_001292006 |
UniProt ID | Q9BTE0 |
◆ Recombinant Proteins | ||
NAT9-78H | Recombinant Human NAT9 Protein, His-tagged | +Inquiry |
NAT9-1197H | Recombinant Human NAT9, GST-tagged | +Inquiry |
NAT9-5922M | Recombinant Mouse NAT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAT9-2950R | Recombinant Rhesus monkey NAT9 Protein, His-tagged | +Inquiry |
NAT9-10442M | Recombinant Mouse NAT9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAT9-3959HCL | Recombinant Human NAT9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT9 Products
Required fields are marked with *
My Review for All NAT9 Products
Required fields are marked with *