Recombinant Human NATD1 Protein, GST-tagged

• Cat.No.: NATD1-4323H
• Product Overview: Human MGC33894 full-length ORF (BAG54382.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: NATD1 (N-Acetyltransferase Domain Containing 1) is a Protein Coding gene.
• Molecular Mass: 39.4 kDa
• AA Sequence: MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NATD1 N-acetyltransferase domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: NATD1
• Synonyms: NATD1; N-acetyltransferase domain containing 1; Gtlf3b; C17orf103; protein NATD1; N-acetyltransferase domain-containing protein 1; gene trap locus F3b; protein GTLF3B; transcript expressed during hematopoiesis 2
• Gene ID: 256302
• mRNA Refseq: NM_152914
• Protein Refseq: NP_690878
• UniProt ID: Q8N6N6