Recombinant Human NATD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NATD1-3100H
Product Overview : C17orf103 MS Standard C13 and N15-labeled recombinant protein (NP_690878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NATD1 (N-Acetyltransferase Domain Containing 1) is a Protein Coding gene. Diseases associated with NATD1 include Potocki-Lupski Syndrome.
Molecular Mass : 13 kDa
AA Sequence : MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYSGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NATD1 N-acetyltransferase domain containing 1 [ Homo sapiens (human) ]
Official Symbol NATD1
Synonyms NATD1; N-acetyltransferase domain containing 1; Gtlf3b; C17orf103; protein NATD1; N-acetyltransferase domain-containing protein 1; gene trap locus F3b; protein GTLF3B; transcript expressed during hematopoiesis 2
Gene ID 256302
mRNA Refseq NM_152914
Protein Refseq NP_690878
UniProt ID Q8N6N6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NATD1 Products

Required fields are marked with *

My Review for All NATD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon