Recombinant Human NATD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NATD1-3100H |
Product Overview : | C17orf103 MS Standard C13 and N15-labeled recombinant protein (NP_690878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NATD1 (N-Acetyltransferase Domain Containing 1) is a Protein Coding gene. Diseases associated with NATD1 include Potocki-Lupski Syndrome. |
Molecular Mass : | 13 kDa |
AA Sequence : | MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYSGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NATD1 N-acetyltransferase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | NATD1 |
Synonyms | NATD1; N-acetyltransferase domain containing 1; Gtlf3b; C17orf103; protein NATD1; N-acetyltransferase domain-containing protein 1; gene trap locus F3b; protein GTLF3B; transcript expressed during hematopoiesis 2 |
Gene ID | 256302 |
mRNA Refseq | NM_152914 |
Protein Refseq | NP_690878 |
UniProt ID | Q8N6N6 |
◆ Recombinant Proteins | ||
NATD1-3100H | Recombinant Human NATD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NATD1-4323H | Recombinant Human NATD1 Protein, GST-tagged | +Inquiry |
Natd1-3331M | Recombinant Mouse Natd1 Protein, Myc/DDK-tagged | +Inquiry |
NATD1-2112Z | Recombinant Zebrafish NATD1 | +Inquiry |
NATD1-6190HF | Recombinant Full Length Human NATD1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NATD1-8241HCL | Recombinant Human C17orf103 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NATD1 Products
Required fields are marked with *
My Review for All NATD1 Products
Required fields are marked with *