Recombinant Human NATD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NATD1-3100H
• Product Overview: C17orf103 MS Standard C13 and N15-labeled recombinant protein (NP_690878) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NATD1 (N-Acetyltransferase Domain Containing 1) is a Protein Coding gene. Diseases associated with NATD1 include Potocki-Lupski Syndrome.
• Molecular Mass: 13 kDa
• AA Sequence: MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEVPDAYSGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NATD1 N-acetyltransferase domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: NATD1
• Synonyms: NATD1; N-acetyltransferase domain containing 1; Gtlf3b; C17orf103; protein NATD1; N-acetyltransferase domain-containing protein 1; gene trap locus F3b; protein GTLF3B; transcript expressed during hematopoiesis 2
• Gene ID: 256302
• mRNA Refseq: NM_152914
• Protein Refseq: NP_690878
• UniProt ID: Q8N6N6