Recombinant Human NCR3 protein, T7/His-tagged

Cat.No. : NCR3-100H
Product Overview : Recombinant human CD337 cDNA (19 – 135 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 19-135 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFLWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGK EVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro non-glycosylated CD337 protein mediated DC or NK cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD337 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ]
Official Symbol NCR3
Synonyms NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117;
Gene ID 259197
mRNA Refseq NM_001145466
Protein Refseq NP_001138938
MIM 611550
UniProt ID O14931
Chromosome Location 6p21.3
Pathway Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCR3 Products

Required fields are marked with *

My Review for All NCR3 Products

Required fields are marked with *

0
cart-icon