Recombinant Human NCR3 protein, T7/His-tagged

• Cat.No.: NCR3-100H
• Product Overview: Recombinant human CD337 cDNA (19 – 135 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 19-135 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFLWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGK EVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated CD337 protein mediated DC or NK cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD337 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens ]
• Official Symbol: NCR3
• Synonyms: NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117
• Gene ID: 259197
• mRNA Refseq: NM_001145466
• Protein Refseq: NP_001138938
• MIM: 611550
• UniProt ID: O14931
• Chromosome Location: 6p21.3
• Pathway: Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem
• Function: receptor activity