Recombinant Human NDUFA12 Protein (1-145 aa), GST-tagged
| Cat.No. : | NDUFA12-2151H |
| Product Overview : | Recombinant Human NDUFA12 Protein (1-145 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-145 aa |
| Description : | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 44.1 kDa |
| AA Sequence : | MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | NDUFA12 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [ Homo sapiens (human) ] |
| Official Symbol | NDUFA12 |
| Synonyms | NDUFA12; B17.2; DAP13; CI-B17.2; EC 1.6.5.3; EC 1.6.99.3; |
| Gene ID | 55967 |
| mRNA Refseq | NM_001258338 |
| Protein Refseq | NP_001245267 |
| MIM | 614530 |
| UniProt ID | Q9UI09 |
| ◆ Recombinant Proteins | ||
| NDUFA12-2973R | Recombinant Rhesus monkey NDUFA12 Protein, His-tagged | +Inquiry |
| NDUFA12-2151H | Recombinant Human NDUFA12 Protein (1-145 aa), GST-tagged | +Inquiry |
| NDUFA12-699H | Recombinant Human NDUFA12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NDUFA12-3389Z | Recombinant Zebrafish NDUFA12 | +Inquiry |
| NDUFA12-5964M | Recombinant Mouse NDUFA12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFA12-3923HCL | Recombinant Human NDUFA12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA12 Products
Required fields are marked with *
My Review for All NDUFA12 Products
Required fields are marked with *
