Recombinant Human NDUFA12 Protein (1-145 aa), GST-tagged
Cat.No. : | NDUFA12-2151H |
Product Overview : | Recombinant Human NDUFA12 Protein (1-145 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-145 aa |
Description : | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.1 kDa |
AA Sequence : | MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | NDUFA12 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [ Homo sapiens (human) ] |
Official Symbol | NDUFA12 |
Synonyms | NDUFA12; B17.2; DAP13; CI-B17.2; EC 1.6.5.3; EC 1.6.99.3; |
Gene ID | 55967 |
mRNA Refseq | NM_001258338 |
Protein Refseq | NP_001245267 |
MIM | 614530 |
UniProt ID | Q9UI09 |
◆ Recombinant Proteins | ||
Ndufa12-4328M | Recombinant Mouse Ndufa12 Protein, Myc/DDK-tagged | +Inquiry |
NDUFA12-699H | Recombinant Human NDUFA12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDUFA12-10513M | Recombinant Mouse NDUFA12 Protein | +Inquiry |
NDUFA12-3389Z | Recombinant Zebrafish NDUFA12 | +Inquiry |
NDUFA12-3597H | Recombinant Human NDUFA12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA12-3923HCL | Recombinant Human NDUFA12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA12 Products
Required fields are marked with *
My Review for All NDUFA12 Products
Required fields are marked with *