Recombinant Human NDUFA12 Protein (1-145 aa), GST-tagged

Cat.No. : NDUFA12-2151H
Product Overview : Recombinant Human NDUFA12 Protein (1-145 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-145 aa
Description : Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 44.1 kDa
AA Sequence : MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name NDUFA12 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 [ Homo sapiens (human) ]
Official Symbol NDUFA12
Synonyms NDUFA12; B17.2; DAP13; CI-B17.2; EC 1.6.5.3; EC 1.6.99.3;
Gene ID 55967
mRNA Refseq NM_001258338
Protein Refseq NP_001245267
MIM 614530
UniProt ID Q9UI09

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA12 Products

Required fields are marked with *

My Review for All NDUFA12 Products

Required fields are marked with *

0
cart-icon